Bromodomain Containing 9 (BRD9) (N-Term) antibody

Details for Product No. ABIN183095
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms LAVS3040, PRO9856, AL022779, zgc:55797, BRD9
Epitope
N-Term
(4), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Zebrafish (Danio rerio), Human, Chicken
(5), (1), (1), (1), (1), (1), (1)
Host
Rabbit
(5)
Clonality
Polyclonal
Application
Western Blotting (WB)
(5)
Pubmed 2 references available
Catalog no. ABIN183095
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human BRD9
Sequence AIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKL MCDNAMTYNR
Predicted Reactivity Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, Bovine : 90 %, Chicken : 90 %, Guinea pig : 90 %, Rabbit : 90 %, African clawed frog : 70 %, Zebrafish : 70 %
Characteristics This is a rabbit polyclonal antibody against BRD9. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name BRD9
Background BRD9 encodes a bromodomain containing 9 protein and is located on chromosome 5.
Molecular Weight 26 kDa
Gene ID 65980
NCBI Accession NM_023924, NP_076413
UniProt Q9H7R9
Research Area Chromatin and Nuclear Signaling, Transcription Factors, Chromatin Binding Proteins
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 233 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Bromodomain Containing 9 (BRD9) (N-Term) antibody WB Suggested Anti-BRD9 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment...." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

General Clark, Edwards, Peterson et al.: "Fugu ESTs: new resources for transcription analysis and genome annotation." in: Genome research, Vol. 13, Issue 12, pp. 2747-53, 2003 (PubMed).

Hosts (5)
Reactivities (5), (1), (1), (1), (1), (1), (1)
Applications (5)
Epitopes (4), (1)
back to top