Death Inducer-Obliterator 1 (DIDO1) (N-Term) antibody

Details for Product No. ABIN183106
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms
BYE1, C20orf158, DATF-1, DATF1, DIDO2, DIDO3, DIO-1, DIO1, dJ885L7.8, Datf1, Dido2, Dido3, mKIAA0333, C530043I07, 6720461J16Rik, D130048F08Rik, datf1l, fi35b04, wu:fi35b04, zgc:158157, DIDO1, DKFZp469 ... show more
BYE1, C20orf158, DATF-1, DATF1, DIDO2, DIDO3, DIO-1, DIO1, dJ885L7.8, Datf1, Dido2, Dido3, mKIAA0333, C530043I07, 6720461J16Rik, D130048F08Rik, datf1l, fi35b04, wu:fi35b04, zgc:158157, DIDO1, DKFZp469J1523, bye1, dio1, datf1, dido2, dido3, dio-1 show less
Epitope
N-Term
(8), (3), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human, Chicken
(40), (26), (17), (2), (2), (2), (1), (1)
Host
Rabbit
(36), (7)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(33), (19), (9), (8), (5), (4), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN183106
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human DIDO1
Sequence ERVEQFLTIARRRGRRSMPVSLEDSGEPTSCPATDAETAS EGSVESASET
Predicted Reactivity Human : 100 %, Rabbit : 100 %, Bovine : 90 %, Chicken : 90 %, Horse : 90 %, Mouse : 90 %, Rat : 90 %, Guinea pig : 80 %
Characteristics This is a rabbit polyclonal antibody against DIDO1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name DIDO1
Background In mice, the death inducer-obliterator-1 gene is upregulated by apoptotic signals and encodes a cytoplasmic protein that translocates to the nucleus upon apoptotic signal activation. When overexpressed, the mouse protein induced apoptosis in cell lines growing in vitro. DIDO1 gene is similar to the mouse gene and therefore is thought to be involved in apoptosis.Apoptosis, a major form of cell death, is an efficient mechanism for eliminating unwanted cells and is of central importance for development and homeostasis in metazoan animals. In mice, the death inducer-obliterator-1 gene is upregulated by apoptotic signals and encodes a cytoplasmic protein that translocates to the nucleus upon apoptotic signal activation. When overexpressed, the mouse protein induced apoptosis in cell lines growing in vitro. This gene is similar to the mouse gene and therefore is thought to be involved in apoptosis. Alternatively spliced transcripts have been found for this gene, encoding multiple isoforms.
Molecular Weight 59 kDa
Gene ID 11083
NCBI Accession NM_080797, NP_542987
UniProt Q9BTC0-2
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 544 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Death Inducer-Obliterator 1 (DIDO1) (N-Term) antibody WB Suggested Anti-DIDO1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
Background publications Fütterer, Campanero, Leonardo et al.: "Dido gene expression alterations are implicated in the induction of hematological myeloid neoplasms." in: The Journal of clinical investigation, Vol. 115, Issue 9, pp. 2351-62, 2005 (PubMed).

Hosts (36), (7)
Reactivities (40), (26), (17), (2), (2), (2), (1), (1)
Applications (33), (19), (9), (8), (5), (4), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (8), (3), (2), (1), (1)
back to top