Did you know that you can buy products from over 140 different suppliers from us?

Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 2 (KCNQ2) (N-Term) antibody

Details for Product No. ABIN183177
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BFNC, BFNS1, EBN, EBN1, EIEE7, ENB1, HNSPC, KCNA11, KV7.2, KVEBN1, KQT2, Nmf134
Epitope
N-Term
(21), (13), (4), (3), (1)
Reactivity
Rabbit, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish (Danio rerio), Cow (Bovine), Human, Chicken
(59), (27), (25), (19), (18), (4), (3), (3), (2)
Host
Rabbit
(43), (23)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(49), (35), (21), (20), (15), (14), (7), (7), (3), (3), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183177
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human KCNQ2
Sequence YRGWRGRLKFARKPFCVIDIMVLIASIAVLAAGSQGNVFA TSALRSLRFL
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, Zebrafish : 90 %
Characteristics This is a rabbit polyclonal antibody against KCNQ2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name KCNQ2
Background The M channel is a slowly activating and deactivating potassium channel that plays a critical role in the regulation of neuronal excitability. The M channel is formed by the association of the protein encoded by KCNQ2 and a related protein encoded by the KCNQ3 gene, both integral membrane proteins. M channel currents are inhibited by M1 muscarinic acetylcholine receptors and activated by retigabine, a novel anti-convulsant drug. Defects in KCNQ2 are a cause of benign familial neonatal convulsions type 1 (BFNC), also known as epilepsy, benign neonatal type 1 (EBN1).
Molecular Weight 93 kDa
Gene ID 3785
NCBI Accession NM_004518, NP_004509
UniProt Q5VYT9
Research Area Neurology
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 844 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 2 (KCNQ2) (N-Term) antibody WB Suggested Anti-KCNQ2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysate
Product cited in: Tang, Li, Xia et al.: "A novel mutation in KCNQ2 gene causes benign familial neonatal convulsions in a Chinese family." in: Journal of the neurological sciences, Vol. 221, Issue 1-2, pp. 31-4, 2004 (PubMed).

Validation Images
back to top