Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 2 (KCNQ2) antibody

Antigen

Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 2 (KCNQ2)

Synonyms EBN, BFNC, EBN1, ENB1, HNSPC, KV7.2, KCNA11, KVEBN1
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken, Rabbit, Zebrafish

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
1 reference available
Catalog no. ABIN183178
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name KCNQ2
Gene ID KCNQ2
UniProt Q5VYU0
Immunogen The immunogen for anti-KCNQ2 antibody: synthetic peptide directed towards the middle region of human KCNQ2
Sequence GNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAH SKELVTAWYI
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rabbit, Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-KCNQ2 antibody concentration is 1 mg/ml.
Description The M channel is a slowly activating and deactivating potassium channel that plays a critical role in the regulation of neuronal excitability. The M channel is formed by the association of the protein encoded by the KCNQ2 gene and a related protein encoded by the KCNQ3 gene, both integral membrane proteins. M channel currents are inhibited by M1 muscarinic acetylcholine receptors and activated by retigabine, a novel anti-convulsant drug. Defects in KCNQ2 are a cause of benign familial neonatal convulsions type 1 (BFNC), also known as epilepsy, benign neonatal type 1 (EBN1).
Characteristics Antigen Size: 393 amino acids
Molecular Weight 43kDa

Application Details

Application Notes WB Suggested Anti-KCNQ2 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Neurology
Restrictions For Research Use only

Publications

Product Tang, Li, Xia et al.: "A novel mutation in KCNQ2 gene causes benign familial neonatal convulsions in a Chinese family." in: Journal of the neurological sciences, Vol. 221, Issue 1-2, pp. 31-4, 2004 (PubMed).

Alternatives

Alternatives for antigen "Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 2 (KCNQ2)", type "Antibodies"
Hosts Rabbit (39), Mouse (7)
Reactivities Human (38), Mouse (Murine) (28), Rat (Rattus) (26), Dog (Canine) (20), Cow (Bovine) (19), Horse (Equine) (18), Sheep (Ovine) (18), Chicken (3), Rabbit (3), Zebrafish (3)
Applications Western Blotting (WB) (28), Immunofluorescence (IF) (18), Immunohistochemistry (IHC) (17), ELISA (7), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (7), Immunoprecipitation (IP) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunocytochemistry (ICC) (2), Immunostaining (ISt) (2), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes Internal Region (4), N-Term (4), AA 1-59 (3), Center (1)