Did you know that you can buy products from over 140 different suppliers from us?

Interleukin Enhancer Binding Factor 2, 45kDa (ILF2) (C-Term) antibody

Details for Product No. ABIN183211
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms nf45, pro3063, ILF2, wu:fb34h01, zgc:73084, zgc:77276, NF45, PRO3063, 6230405A16Rik, TEG-267, Tex261, Tex267
Epitope
C-Term
(7), (6), (5), (4), (2), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human
(38), (6), (4), (4), (1)
Host
Rabbit
(26), (7), (7)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (3), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(38), (25), (11), (6), (6), (3), (2)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183211
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human ILF2
Sequence HGGFRKILGQEGDASYLASEISTWDGVIVTPSEKAYEKPP EKKEGEEEEE
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, African clawed frog : 90 %, Zebrafish : 90 %
Characteristics This is a rabbit polyclonal antibody against ILF2. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name ILF2
Background Nuclear factor of activated T-cells (NFAT) is a transcription factor required for T-cell expression of the interleukin 2 gene. NFAT binds to a sequence in the interleukin 2 gene enhancer known as the antigen receptor response element 2. In addition, NFAT can bind RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. NFAT is a heterodimer of 45 kDa and 90 kDa proteins, the smaller of which is the product of the ILF2 gene. The encoded protein binds strongly to the 90 kDa protein and stimulates its ability to enhance gene expression.
Molecular Weight 43 kDa
Gene ID 3608
NCBI Accession NM_004515, NP_004506
UniProt Q12905
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 390 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Interleukin Enhancer Binding Factor 2, 45kDa (ILF2) (C-Term) antibody WB Suggested Anti-ILF2 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
anti-Interleukin Enhancer Binding Factor 2, 45kDa (ILF2) (C-Term) antibody (2) Sample Type: MCF-7 WT a whole cell lysates (110UG)
Primary Dilution: 1.5mg/mL
Secondary Antibody: LI-COR Donkey anti-rabbit
Secondary Dilution: 1:10,000

anti-Interleukin Enhancer Binding Factor 2, 45kDa (ILF2) (C-Term) antibody (3) anti-Interleukin Enhancer Binding Factor 2, 45kDa (ILF2) (C-Term) antibody (Image 3)
anti-Interleukin Enhancer Binding Factor 2, 45kDa (ILF2) (C-Term) antibody (4) Host: Rabbit
Target Name: ILF2
Sample Tissue: Jurkat
Lane A: Primary Antibody Lane B: Primary Antibody + Blocking Peptide
Primary Antibody Concentration: 2.5 µg/mL Peptide Concentration:..0 µg/mL Lysate Quantity:.41 µg/laneGel Concentration: 12 %
anti-Interleukin Enhancer Binding Factor 2, 45kDa (ILF2) (C-Term) antibody (5) Human kidney
anti-Interleukin Enhancer Binding Factor 2, 45kDa (ILF2) (C-Term) antibody (6) WB Suggested Anti-ILF2
Antibody Titration: 1.25 µg/mL ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
Background publications Shin, Kim, Cho et al.: "Host cell proteins binding to the encapsidation signal epsilon in hepatitis B virus RNA." in: Archives of virology, Vol. 147, Issue 3, pp. 471-91, 2002 (PubMed).

Validation Images
back to top