Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183219

High Mobility Group Box 3 (HMGB3) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HMG-2a, HMG-4, HMG2A, HMG4, Hmg4, Hmg2a, RGD1564407, hmgb3, fa19b06, fj43d02, wu:fa19b06, wu:fj43d02, zgc:112073, HMG-1, HMG2a, HMGB1, MGC54022, Xhmgb3, MGC88931, HMGB3
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN183219
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-HMGB3 antibody: synthetic peptide directed towards the C terminal of human HMGB3
Sequence NLNDSEKQPYITKAAKLKEKYEKDVADYKSKGKFDGAKGP AKVARKKVEE
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 76%
Characteristics This is a rabbit polyclonal antibody against HMGB3. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name HMGB3
Background The human HMG2a gene is transcribed mainly in the placenta. HMG2a encodes a protein which is part of the high mobility group (HMG) family. Members of this family are ubiquitously expressed and facilitate the formation of nucleoprotein complexes where the DNA is sharply bent.
Molecular Weight 23kDa
Gene ID 3149
NCBI Accession NP_005333, NM_005342
UniProt O15347
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-HMGB3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Vaccari, Beltrame, Ferrari et al.: "Hmg4, a new member of the Hmg1/2 gene family." in: Genomics, Vol. 49, Issue 2, pp. 247-52, 1998 (PubMed).

Alternatives for antigen "High Mobility Group Box 3 (HMGB3)", type "Antibodies"
Hosts (20), (6), (2)
Reactivities (24), (9), (6), (3), (3), (3), (2), (1), (1), (1)
Applications (27), (6), (4), (4), (2), (2), (1), (1), (1)
Epitopes (5), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Beacon