High Mobility Group Box 3 (HMGB3) (C-Term) antibody

Details for Product No. ABIN183219
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms HMG-2a, HMG-4, HMG2A, HMG4, Hmg4, Hmg2a, RGD1564407, hmgb3, fa19b06, fj43d02, wu:fa19b06, wu:fj43d02, zgc:112073, HMG-1, HMG2a, HMGB1, MGC54022, Xhmgb3, MGC88931, HMGB3
Epitope
C-Term
(5), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
(23), (7), (4), (3), (2), (2), (1)
Host
Rabbit
(19), (5), (1)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(24), (6), (6), (3), (2), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN183219
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human HMGB3
Sequence NLNDSEKQPYITKAAKLKEKYEKDVADYKSKGKFDGAKGP AKVARKKVEE
Predicted Reactivity African clawed frog : 100 %, Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 70 %
Characteristics This is a rabbit polyclonal antibody against HMGB3. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name HMGB3
Background The human HMG2a gene is transcribed mainly in the placenta. HMG2a encodes a protein which is part of the high mobility group (HMG) family. Members of this family are ubiquitously expressed and facilitate the formation of nucleoprotein complexes where the DNA is sharply bent.
Molecular Weight 23 kDa
Gene ID 3149
NCBI Accession NM_005342, NP_005333
UniProt O15347
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 200 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-High Mobility Group Box 3 (HMGB3) (C-Term) antibody anti-High Mobility Group Box 3 (HMGB3) (C-Term) antibody
Background publications Vaccari, Beltrame, Ferrari et al.: "Hmg4, a new member of the Hmg1/2 gene family." in: Genomics, Vol. 49, Issue 2, pp. 247-52, 1998 (PubMed).

Hosts (19), (5), (1)
Reactivities (23), (7), (4), (3), (2), (2), (1)
Applications (24), (6), (6), (3), (2), (1), (1), (1)
Epitopes (5), (2), (2), (2), (2), (1), (1), (1), (1), (1)
back to top