Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183228

Zinc Finger Protein 266 (ZNF266) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HZF1, 5330440G10Rik, 5730601F06Rik, AW552317, Zfp426, Zfp426l, Znf266, ZNF266, ZNF426
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN183228
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF266 antibody: synthetic peptide directed towards the N terminal of human ZNF266
Sequence EESRTVQRGDFQASEWKVQLKTKELALQQDVLGEPTSSGI QMIGSHNGGE
Predicted Reactivity Human :100%,  
Characteristics This is a rabbit polyclonal antibody against ZNF266. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name ZNF266
Background Located on chromosome 19, ZNF266 is part of the Kruppel-related zinc finger gene family.
Molecular Weight 62kDa
Gene ID 10781
NCBI Accession NP_932175, NM_198058
UniProt Q14584
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF266 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Abrink, Aveskogh, Hellman: "Isolation of cDNA clones for 42 different Krüppel-related zinc finger proteins expressed in the human monoblast cell line U-937." in: DNA and cell biology, Vol. 14, Issue 2, pp. 125-36, 1995 (PubMed).

Alternatives for antigen "Zinc Finger Protein 266 (ZNF266)", type "Antibodies"
Hosts (26), (5)
Reactivities (31), (12), (12), (1)
Applications (22), (10), (10), (5), (5), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (2), (1), (1), (1)
Beacon