Zinc Finger Protein 266 (ZNF266) (N-Term) antibody

Details for Product No. ABIN183228
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 5330440G10Rik, 5730601F06Rik, AW552317, Zfp426, Zfp426l, Znf266, ZNF266, ZNF426, HZF1
Epitope
N-Term
(3), (3), (2), (1), (1), (1), (1), (1)
Reactivity
Human
(34), (12), (12), (1)
Host
Rabbit
(28), (6)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(25), (10), (7), (6), (5), (3), (2), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183228
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF266
Sequence EESRTVQRGDFQASEWKVQLKTKELALQQDVLGEPTSSGI QMIGSHNGGE
Predicted Reactivity Human :100 %,  
Characteristics This is a rabbit polyclonal antibody against ZNF266. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name ZNF266
Background Located on chromosome 19, ZNF266 is part of the Kruppel-related zinc finger gene family.
Molecular Weight 62 kDa
Gene ID 10781
NCBI Accession NM_198058, NP_932175
UniProt Q14584
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 549 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 266 (ZNF266) (N-Term) antibody WB Suggested Anti-ZNF266 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate
anti-Zinc Finger Protein 266 (ZNF266) (N-Term) antibody (2) anti-Zinc Finger Protein 266 (ZNF266) (N-Term) antibody (Image 2)
Background publications Abrink, Aveskogh, Hellman: "Isolation of cDNA clones for 42 different Krüppel-related zinc finger proteins expressed in the human monoblast cell line U-937." in: DNA and cell biology, Vol. 14, Issue 2, pp. 125-36, 1995 (PubMed).

Validation Images
back to top