Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183262

Zinc Finger Protein 529 (ZNF529) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF529
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183262
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF529 antibody: synthetic peptide directed towards the N terminal of human ZNF529
Sequence QMKIISENVPSYKTHESLTLPRRTHDSEKPYEYKEYEKVF SCDLEFDEYQ
Predicted Reactivity Human :100%,   Mouse :90%,   Crab-eating macaque :76%,   Sumatran orangutan :76%,  
Characteristics This is a rabbit polyclonal antibody against ZNF529. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF529
Background The function of the Anti-ZNF529 gene has not yet been determined
Molecular Weight 54kDa
Gene ID 57711
NCBI Accession NP_066002, NM_020951
UniProt Q9H731
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF529 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Alternatives for antigen "Zinc Finger Protein 529 (ZNF529)", type "Antibodies"
Hosts (8), (1)
Reactivities (9), (1), (1), (1)
Applications (9), (1), (1)
Epitopes (3), (1), (1), (1)
Beacon