Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger Protein 529 (ZNF529) (N-Term) antibody

Details for Product No. ABIN183262
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF529
Epitope
N-Term
(3), (1), (1), (1)
Reactivity
Mouse (Murine), Human
(9), (1), (1), (1)
Host
Rabbit
(8), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(9), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183262
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF529
Sequence QMKIISENVPSYKTHESLTLPRRTHDSEKPYEYKEYEKVF SCDLEFDEYQ
Predicted Reactivity Human :100 %,   Mouse :90 %,   Crab-eating macaque :70 %,   Sumatran orangutan :70 %,  
Characteristics This is a rabbit polyclonal antibody against ZNF529. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF529
Background The function of the Anti-ZNF529 gene has not yet been determined
Molecular Weight 54 kDa
Gene ID 57711
NCBI Accession NM_020951, NP_066002
UniProt Q9H731
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 458 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 529 (ZNF529) (N-Term) antibody WB Suggested Anti-ZNF529 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Validation Images
back to top