Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger Protein 322A (ZNF322A) (N-Term) antibody

Details for Product No. ABIN183270
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF322A, HCG12, ZNF388, ZNF489, 9630054P07Rik, Znf322, Znf322a
Epitope
N-Term
(10), (7), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(19), (1), (1)
Host
Rabbit
(19)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(19), (9), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183270
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF322A
Sequence RTHTGEKPYKCDMCEKTFVQSSDLTSHQRIHNYEKPYKCS KCEKSFWHHL
Predicted Reactivity Horse : 92 %, Bovine : 82 %
Characteristics This is a rabbit polyclonal antibody against ZNF322A. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF322A
Background ZNF322 contains four exons and spans 23.2kb in chromosome 6p22.1 region, and transcribes a 2.7kb mRNA that encodes a protein with 402 amino acid residues.Through northern blot analysis, ZNF322 was shown to be expressed in every human tissue examined at adult stage and during embryonic developmental stages from 80 days to 24 weeks. When ZNF322 was overexpressed in COS-7 cells, ZNF322-EGFP fusion protein is detected in the nucleus and cytoplasm. Reporter gene assays show that ZNF322 is a transcriptional activator. Furthermore, overexpression of ZNF322 in COS-7 cells activates the transcriptional activity of SRE and AP-1. Together, these results suggest that ZNF322 is a member of the zinc-finger transcription factor family and may act as a positive regulator in gene transcription mediated by the MAPK signaling pathways.
Molecular Weight 47 kDa
Gene ID 79692
NCBI Accession NM_024639, NP_078915
UniProt Q6U7Q0
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 402 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 322A (ZNF322A) (N-Term) antibody WB Suggested Anti-ZNF322A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Validation Images
back to top