Zinc Finger Protein 419 (ZNF419) (N-Term) antibody

Details for Product No. ABIN183271
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms ZNF419A, ZNF419
Epitope
N-Term
(5), (2), (1)
Reactivity
Human
(13), (2), (1), (1)
Host
Rabbit
(12), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(13), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN183271
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF419
Sequence MAAAALRDPAQVPVAADLLTDHEEGYVTFEDVAVYFSQEE WRLLDDAQRL
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against ZNF419. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF419
Background The function of Anti-ZNF419 has not yet been determined.
Molecular Weight 59 kDa
Gene ID 79744
NCBI Accession NM_024691, NP_078967
UniProt Q96HQ0
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 510 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 419 (ZNF419) (N-Term) antibody WB Suggested Anti-ZNF419 Antibody Titration: 0.125ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Hosts (12), (1)
Reactivities (13), (2), (1), (1)
Applications (13), (1), (1), (1)
Epitopes (5), (2), (1)
back to top