Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183271

Zinc Finger Protein 419 (ZNF419) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF419A, ZNF419
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183271
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF419 antibody: synthetic peptide directed towards the N terminal of human ZNF419
Sequence MAAAALRDPAQVPVAADLLTDHEEGYVTFEDVAVYFSQEE WRLLDDAQRL
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against ZNF419. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF419
Background The function of Anti-ZNF419 has not yet been determined.
Molecular Weight 59kDa
Gene ID 79744
NCBI Accession NP_078967, NM_024691
UniProt Q96HQ0
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF419 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Alternatives for antigen "Zinc Finger Protein 419 (ZNF419)", type "Antibodies"
Hosts (13)
Reactivities (13), (2), (1), (1)
Applications (13), (1)
Epitopes (5), (2), (2), (1), (1), (1)
Beacon