Did you know that you can buy products from over 140 different suppliers from us?

Homeobox A3 (HOXA3) (C-Term) antibody

Details for Product No. ABIN183277
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HOX1, HOX1E, Mo-10, Hox-1.5, cb332, hoxa3, fa10d03, wu:fa10d03, RGD1561431, hox1e, hoxa-3, hoxa3a, MGC52707, HOXA3, hox1
Epitope
C-Term
(19), (8), (7), (2), (2), (2), (2), (1), (1)
Reactivity
Rabbit, Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Human, Chicken
(29), (25), (16), (13), (13), (12), (1)
Host
Rabbit
(38), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(30), (16), (10), (10), (8), (6), (2), (2)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN183277
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human HOXA3
Sequence MQKATYYDSSAIYGGYPYQAANGFAYNANQQPYPASAALG ADGEYHRPAC
Predicted Reactivity Human : 100 %, Dog : 90 %, Guinea pig : 90 %, Pig : 90 %, Rabbit : 90 %
Characteristics This is a rabbit polyclonal antibody against HOXA3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name HOXA3
Background In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. The HOXA3 gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation.
Molecular Weight 46 kDa
Gene ID 3200
NCBI Accession NM_030661, NP_109377
UniProt O43365
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 443 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Homeobox A3 (HOXA3) (C-Term) antibody WB Suggested Anti-HOXA3 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
Background publications Scherer, Cheung, MacDonald et al.: "Human chromosome 7: DNA sequence and biology." in: Science (New York, N.Y.), Vol. 300, Issue 5620, pp. 767-72, 2003 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183277
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top