Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183277

Homeobox A3 (HOXA3) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HOX1, HOX1E, Mo-10, Hox-1.5, cb332, hoxa3, fa10d03, wu:fa10d03, RGD1561431, hox1e, hoxa-3, hoxa3a, MGC52707, HOXA3, hox1
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Rabbit, Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183277
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-HOXA3 antibody: synthetic peptide directed towards the C terminal of human HOXA3
Sequence MQKATYYDSSAIYGGYPYQAANGFAYNANQQPYPASAALG ADGEYHRPAC
Predicted Reactivity Human : 100%, Dog : 92%, Guinea pig : 92%, Pig : 92%, Rabbit : 92%
Characteristics This is a rabbit polyclonal antibody against HOXA3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name HOXA3
Background In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. The HOXA3 gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation.
Molecular Weight 46kDa
Gene ID 3200
NCBI Accession NP_109377, NM_030661
UniProt O43365
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-HOXA3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Scherer, Cheung, MacDonald et al.: "Human chromosome 7: DNA sequence and biology." in: Science (New York, N.Y.), Vol. 300, Issue 5620, pp. 767-72, 2003 (PubMed).

Alternatives for antigen "Homeobox A3 (HOXA3)", type "Antibodies"
Hosts (26), (3)
Reactivities (23), (19), (16), (13), (13), (12), (1)
Applications (18), (10), (6), (4), (4), (3), (2), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (9), (2), (2), (2), (2), (2), (2), (1), (1)
Beacon