Did you know that you can buy products from over 140 different suppliers from us?

ALX Homeobox 4 (ALX4) (N-Term) antibody

Details for Product No. ABIN183394
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms lst, FND2, im:7142878, zgc:162606, alx4
Epitope
N-Term
(8), (8), (5), (3), (2), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(33), (12), (6), (4), (3), (1)
Host
Rabbit
(27), (11)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(37), (11), (10), (2), (1), (1)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN183394
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ALX4
Sequence SSPFRAFPGGDKFGTTFLSAAAKAQGFGDAKSRARYGAGQ QDLATPLESG
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Human : 100 %, Mouse : 100 %, Rat : 90 %
Characteristics This is a rabbit polyclonal antibody against ALX4. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name ALX4
Background ALX4 may be rendered functionally haploinsufficient by a position effect
Molecular Weight 44 kDa
Gene ID 60529
NCBI Accession NM_021926, NP_068745
UniProt Q9H161
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 411 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-ALX Homeobox 4 (ALX4) (N-Term) antibody WB Suggested Anti-ALX4 Antibody Titration: 0.625ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
Background publications Wakui, Gregato, Ballif et al.: "Construction of a natural panel of 11p11.2 deletions and further delineation of the critical region involved in Potocki-Shaffer syndrome." in: European journal of human genetics : EJHG, Vol. 13, Issue 5, pp. 528-40, 2005 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183394
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top