Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183458

Myocyte Enhancer Factor 2A (MEF2A) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ADCAD1, RSRFC4, RSRFC9, mef2, A430079H05Rik, mef2a, wu:fd19d02, adcad1, rsrfc4, rsrfc9, sl2, MEF2A, xmef2a
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Dog (Canine), Pig (Porcine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183458
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MEF2A antibody: synthetic peptide directed towards the N terminal of mouse MEF2A
Sequence ESRTNSDIVETLRKKGLNGCESPDADDYFEHSPLSEDRFS KLNEDSDFIF
Predicted Reactivity Chicken : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%
Characteristics This is a rabbit polyclonal antibody against MEF2A. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name MEF2A
Background MEF2a belongs to MEF2 family. Members of MEF2 family of transcription factors bind a conserved A/T-rich sequence in the control regions of numerous muscle-specific genes
Molecular Weight 55kDa
Gene ID 17258
NCBI Accession NP_038625, NM_013597
UniProt Q6P8Q3
Research Area Cardiovascular, Hypertrophy, Cardiogenesis, Transcription Factors, Neurogenesis
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MEF2A antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Naya, Black, Wu et al.: "Mitochondrial deficiency and cardiac sudden death in mice lacking the MEF2A transcription factor." in: Nature medicine, Vol. 8, Issue 11, pp. 1303-9, 2002 (PubMed).

Alternatives for antigen "Myocyte Enhancer Factor 2A (MEF2A)", type "Antibodies"
Hosts (178), (23)
Reactivities (195), (141), (128), (27), (27), (3), (3), (3), (2), (1), (1)
Applications (112), (73), (62), (61), (50), (40), (10), (6), (4), (2)
Conjugates (4), (4), (4), (4), (4), (4), (4), (4), (4), (4), (4)
Epitopes (30), (28), (28), (13), (6), (5), (5), (3), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Beacon