Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

SWI/SNF Related, Matrix Associated, Actin Dependent Regulator of Chromatin, Subfamily A, Member 1 (SMARCA1) antibody

Antigen

SWI/SNF Related, Matrix Associated, Actin Dependent Regulator of Chromatin, Subfamily A, Member 1 (SMARCA1)
Synonyms SWI, ISWI, SWI2, SNF2L, SNF2L1, SNF2LB, NURF140, FLJ41547, DKFZp686D1623, snf2l, MGC80667, SMARCA1, DKFZp459M1930, Snf2l, 5730494M04Rik, RGD1561046
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Mouse (Murine), Rat (Rattus)
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN183500
Quantity 100 µg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-SWI/SNF Related, Matrix Associated, Actin Dependent Regulator of Chromatin, Subfamily A, Member 1 (SMARCA1) antibody

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name SMARCA1
Gene ID SMARCA1
UniProt Q8BS67
Immunogen The immunogen for anti-SMARCA1 antibody: synthetic peptide directed towards the N terminal of mouse SMARCA1
Sequence VAVSDARATVVVVEDEQPGPSTFKEEGAAAAATEGTTATE KGEKKEKITS
Cross-Reactivity Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-SMARCA1 antibody concentration is 1 mg/ml.
Description CDNA library was prepared and sequenced in Mouse Genome Encyclopedia Project of Genome Exploration Research Group in Riken Genomic Sciences Center and Genome Science Laboratory in RIKEN.
Characteristics Antigen Size: 381 amino acids
Molecular Weight 43kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-SMARCA1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: NIH/3T3 cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Product Okazaki, Furuno, Kasukawa et al.: "Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs." in: Nature, Vol. 420, Issue 6915, pp. 563-73, 2002 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "SWI/SNF Related, Matrix Associated, Actin Dependent Regulator of Chromatin, Subfamily A, Member 1 (SMARCA1)", type "Antibodies"
Hosts Rabbit (30)
Reactivities Human (29), Mouse (Murine) (20), Rat (Rattus) (20), Chicken (19), Cow (Bovine) (18), Horse (Equine) (18), Pig (Porcine) (18), Dog (Canine) (2)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (13), ELISA (7), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoprecipitation (IP) (2), Dot Blot (DB) (1), Flow Cytometry (FACS) (1), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes N-Term (4), C-Term (2), AA 1004-1054 (1), AA 1042-1054 (1), C-Term,AA 931-961 (1)