Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183550

DEAH (Asp-Glu-Ala-His) Box Polypeptide 16 (DHX16) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DBP2, DDX16, PRO2014, PRP8, PRPF2, Prp2, Ddx16, mKIAA0577, 2410006N22Rik, Dbp2, fa91b12, zgc:55590, wu:fa91b12, dbp2, ddx16, pro2014, prp2, prp8, prpf2, DHX16, DKFZp459L1130
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Pig (Porcine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183550
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-DHX16 antibody: synthetic peptide directed towards the N terminal of human DHX16
Sequence KYQLVLEEEETIEFVRATQLQGDEEPSAPPTSTQAQQKES IQAVRRSLPV
Predicted Reactivity Human : 100%, Bovine : 85%, Goat : 85%, Pig : 84%
Characteristics This is a rabbit polyclonal antibody against DHX16. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name DHX16
Background DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is a functional homolog of fission yeast Prp8 protein involved in cell cycle progression. This gene is mapped to the MHC region on chromosome 6p21.3, a region where many malignant, genetic and autoimmune disease genes are linked.
Molecular Weight 115kDa
Gene ID 8449
NCBI Accession NP_003578, NM_003587
UniProt O60231
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-DHX16 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Beausoleil, Jedrychowski, Schwartz et al.: "Large-scale characterization of HeLa cell nuclear phosphoproteins." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 101, Issue 33, pp. 12130-5, 2004 (PubMed).

Alternatives for antigen "DEAH (Asp-Glu-Ala-His) Box Polypeptide 16 (DHX16)", type "Antibodies"
Hosts (8), (6)
Reactivities (13), (2), (2)
Applications (11), (3), (3), (3), (2), (2), (1)
Epitopes (4), (1), (1)
Beacon