Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183616

LIM Homeobox Transcription Factor 1, beta (LMX1B) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms LMX1.2, NPS1, LMX, LMX1, LMX1.1, lmx1b, lmx1b.1, Xlmx1b
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Human, Zebrafish (Danio rerio), Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183616
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-LMX1B antibody: synthetic peptide directed towards the C terminal of human LMX1B
Sequence QSPYGSSDPFQQGLTPPQMPGNDSIFHDIDSDTSLTSLSD CFLGSSDVGS
Predicted Reactivity Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 100%, African clawed frog : 92%
Characteristics This is a rabbit polyclonal antibody against LMX1B. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name LMX1B
Background LMX1B is essential for the specification of dorsal limb fate at both the zeugopodal and autopodal levels. Defects in LMX1B are the cause of nail-patella syndrome (NPS) also knowan as Onychoosteodysplasia.
Molecular Weight 42kDa
Gene ID 4010
NCBI Accession NP_002307, NM_002316
UniProt Q6ISC9
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-LMX1B antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Bongers, Huysmans, Levtchenko et al.: "Genotype-phenotype studies in nail-patella syndrome show that LMX1B mutation location is involved in the risk of developing nephropathy." in: European journal of human genetics : EJHG, Vol. 13, Issue 8, pp. 935-46, 2005 (PubMed).

Alternatives for antigen "LIM Homeobox Transcription Factor 1, beta (LMX1B)", type "Antibodies"
Hosts (33), (5), (4)
Reactivities (42), (32), (20), (12), (12), (12)
Applications (30), (22), (11), (10), (5), (4), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (8), (5), (2), (2), (1), (1), (1)
Beacon