Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183627

Ring Finger Protein 1 (RING1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RNF1, RING1A, Ring1A
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Dog (Canine), Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183627
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RING1 antibody: synthetic peptide directed towards the N terminal of human RING1
Sequence MTTPANAQNASKTWELSLYELHRTPQEAIMDGTEIAVSPR SLHSELMCPI
Predicted Reactivity Bovine : 100%, Dog : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against RING1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name RING1
Background RING1 can bind DNA and can act as a transcriptional repressor. It is associated with the multimeric polycomb group protein complex. The gene product interacts with the polycomb group proteins BMI1, EDR1, and CBX4, and colocalizes with these proteins in la
Molecular Weight 42kDa
Gene ID 6015
NCBI Accession NP_002922, NM_002931
UniProt Q06587
Research Area Chromatin and Nuclear Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RING1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ogawa, Ishiguro, Gaubatz et al.: "A complex with chromatin modifiers that occupies E2F- and Myc-responsive genes in G0 cells." in: Science (New York, N.Y.), Vol. 296, Issue 5570, pp. 1132-6, 2002 (PubMed).

Alternatives for antigen "Ring Finger Protein 1 (RING1)", type "Antibodies"
Hosts (33), (19)
Reactivities (52), (22), (20), (15), (13), (13), (12)
Applications (42), (25), (10), (6), (4), (2), (1), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (9), (4), (3), (3), (2), (2), (1), (1), (1)
Beacon