Zinc Finger Protein 36, C3H Type, Homolog (Mouse) (ZFP36) antibody

Antigen: Zinc Finger Protein 36, C3H Type, Homolog (Mouse) (ZFP36)

Synonyms: TTP, G0S24, GOS24, TIS11, NUP475, RNF162A, ttp, c3h-1, g0s24, gos24, tis11, nup475, rnf162a, MGC83426, MGC132279, ZFP36, MGC140545, C3H-1

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN183636

Additional Information

Alternative name: Tristetraproline (TTP)

Gene ID: ZFP36

UniProt: P26651

Immunogen: The immunogen for anti-ZFP36 antibody: synthetic peptide directed towards the N terminal of human ZFP36

Sequence: MDLTAIYESLLSLSPDVPVPSDHGGTESSPGWGSSGPWSL SPSDSSPSGV

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZFP36 antibody concentration is 1 mg/ml.

Description: ZFP36 is a probable regulatory protein with a novel zinc finger structure involved in regulating the response to growth factors. Knockdown of ZFP36 increased both cognate macrophage gene mRNAs and inflammatory tumor necrosis factor protein release. Overexpression of ZFP36 resulted in decreased levels of the same genes supporting its role in regulating macrophage gene expression. Multiple phosphorylation sites in ZFP36 in mammalian cells were reported. ZFP36 can be phosphorylated by JNK as well as by the other members of the greater MAP kinase family. Gene expression profiling predicts clinical outcome of prostate cancer. Inappropriate ZFP36 production may be one factor that contributes to higher rheumatoid arthritis disease activity.

Characteristics: Antigen Size: 326 amino acids

Molecular Weight: 34kDa

Application Details

Application Notes: WB Suggested Anti-ZFP36 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Lung.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ZFP36 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Lung

Publications

Product: Cao, Deterding, Venable et al.: "Identification of the anti-inflammatory protein tristetraprolin as a hyperphosphorylated protein by mass spectrometry and site-directed mutagenesis." in: The Biochemical journal, Vol. 394, Issue Pt 1, pp. 285-97, 2006 (PubMed).