Sin3A-Associated Protein, 18kDa (SAP18) (N-Term) antibody

Details for Product No. ABIN183693
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms 2HOR0202, SAP18P, C530046K05Rik, D11Ertd539e, EMegR4, Sinbp1, zgc:73118
Epitope
N-Term
(4), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
(15), (3), (3)
Host
Rabbit
(11), (4)
Clonality
Polyclonal
Application
Western Blotting (WB)
(14), (7), (5), (4), (3), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN183693
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human SAP18
Sequence EIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGN VPSSELQIYT
Predicted Reactivity African clawed frog : 100 %, Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 90 %
Characteristics This is a rabbit polyclonal antibody against SAP18. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SAP18
Background Histone acetylation plays a key role in the regulation of eukaryotic gene expression. Histone acetylation and deacetylation are catalyzed by multisubunit complexes. SAP18 is a component of the histone deacetylase complex, which includes SIN3, SAP30, HDAC1, HDAC2, RbAp46, RbAp48, and other polypeptides. This protein directly interacts with SIN3 and enhances SIN3-mediated transcriptional repression when tethered to the promoter.Histone acetylation plays a key role in the regulation of eukaryotic gene expression. Histone acetylation and deacetylation are catalyzed by multisubunit complexes. The protein encoded by this gene is a component of the histone deacetylase complex, which includes SIN3, SAP30, HDAC1, HDAC2, RbAp46, RbAp48, and other polypeptides. This protein directly interacts with SIN3 and enhances SIN3-mediated transcriptional repression when tethered to the promoter.
Molecular Weight 18 kDa
Gene ID 10284
NCBI Accession NM_005870, NP_005861
UniProt O00422
Research Area Chromatin and Nuclear Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 153 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Zhang, Iratni, Erdjument-Bromage et al.: "Histone deacetylases and SAP18, a novel polypeptide, are components of a human Sin3 complex." in: Cell, Vol. 89, Issue 3, pp. 357-64, 1997 (PubMed).

Hosts (11), (4)
Reactivities (15), (3), (3)
Applications (14), (7), (5), (4), (3), (2), (1)
Epitopes (4), (2), (2), (1), (1), (1)
back to top