Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183707

DPF2 (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Req, ubi-d4, 2210010M07Rik, REQ, UBID4, im:7146797, zgc:101789, req, xReq, req-A, Requiem
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183707
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-DPF2 antibody: synthetic peptide directed towards the N terminal of human DPF2
Sequence MAAVVENVVKLLGEQYYKDAMEQCHNYNARLCAERSVRLP FLDSQTGVAQ
Predicted Reactivity Bovine : 100%, Dog : 100%, Goat : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 85%
Characteristics This is a rabbit polyclonal antibody against DPF2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Background DPF2 is a member of the d4 domain family, characterized by a zinc finger-like structural motif. DPF2 functions as a transcription factor which is necessary for the apoptotic response following deprivation of survival factors. It likely serves a regulatory
Molecular Weight 44kDa
Gene ID 5977
NCBI Accession NP_006259, NM_006268
UniProt Q92785
Research Area Chromatin and Nuclear Signaling, Transcription Factors, Apoptosis/Necrosis
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-DPF2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Beausoleil, Jedrychowski, Schwartz et al.: "Large-scale characterization of HeLa cell nuclear phosphoproteins." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 101, Issue 33, pp. 12130-5, 2004 (PubMed).

Alternatives for antigen "DPF2", type "Antibodies"
Hosts (43), (13)
Reactivities (56), (33), (16), (14), (14), (3), (3), (2), (2)
Applications (44), (29), (11), (9), (9), (3), (3), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (8), (7), (4), (3), (1), (1), (1)
Beacon