Did you know that you can buy products from over 140 different suppliers from us?

DPF2 (N-Term) antibody

Details for Product No. ABIN183707
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Req, ubi-d4, 2210010M07Rik, REQ, UBID4, im:7146797, zgc:101789, req, xReq, req-A, Requiem
Epitope
N-Term
(10), (8), (6), (3), (2), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human, Chicken
(66), (32), (16), (14), (14), (3), (3), (2), (2)
Host
Rabbit
(46), (20)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(53), (33), (11), (9), (9), (8), (8), (3), (2), (2)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN183707
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human DPF2
Sequence MAAVVENVVKLLGEQYYKDAMEQCHNYNARLCAERSVRLP FLDSQTGVAQ
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Goat : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against DPF2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Background DPF2 is a member of the d4 domain family, characterized by a zinc finger-like structural motif. DPF2 functions as a transcription factor which is necessary for the apoptotic response following deprivation of survival factors. It likely serves a regulatory
Molecular Weight 44 kDa
Gene ID 5977
NCBI Accession NM_006268, NP_006259
UniProt Q92785
Research Area Chromatin and Nuclear Signaling, Transcription Factors, Apoptosis/Necrosis
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 391 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-DPF2 (N-Term) antibody WB Suggested Anti-DPF2 Antibody Titration: 0.3125ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate
Background publications Beausoleil, Jedrychowski, Schwartz et al.: "Large-scale characterization of HeLa cell nuclear phosphoproteins." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 101, Issue 33, pp. 12130-5, 2004 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183707
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top