Tripartite Motif Containing 38 (TRIM38) (N-Term) antibody

Details for Product No. ABIN183711
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms RNF15, RORET, Gm23, TRIM38
Epitope
N-Term
(4), (3), (2), (1), (1), (1), (1), (1)
Reactivity
Human
(52), (23), (13)
Host
Rabbit
(37), (15)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(41), (13), (13), (10), (5), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN183711
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human TRIM38
Sequence MASTTSTKKMMEEATCSICLSLMTNPVSINCGHSYCHLCI TDFFKNPSQK
Predicted Reactivity Human : 100 %, Pig : 70 %
Characteristics This is a rabbit polyclonal antibody against TRIM38. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name TRIM38
Background TRIM38 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The function of this protein has not been identified.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The function of this protein has not been identified.
Molecular Weight 53 kDa
Gene ID 10475
NCBI Accession NM_006355, NP_006346
UniProt O00635
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 465 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Tripartite Motif Containing 38 (TRIM38) (N-Term) antibody WB Suggested Anti-TRIM38 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate
Background publications Matsuda, Suzuki, Honda et al.: "Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways." in: Oncogene, Vol. 22, Issue 21, pp. 3307-18, 2003 (PubMed).

Hosts (37), (15)
Reactivities (52), (23), (13)
Applications (41), (13), (13), (10), (5), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (3), (2), (1), (1), (1), (1), (1)
back to top