Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Zinc Finger Protein 36, C3H Type-Like 2 (ZFP36L2) antibody

Antigen

Zinc Finger Protein 36, C3H Type-Like 2 (ZFP36L2)

Synonyms BRF2, ERF2, ERF-2, TIS11D, RNF162C, Brf2, Tis11d, fi22c11, wu:fi22c11, ZFP36L2, zfp36l2, MGC52716, c3h-3, XC3H-3b, brf2, erf2, erf-2, tis11d, rnf162c
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN183726
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name ZFP36L2
Gene ID ZFP36L2
UniProt Q53TB4
Immunogen The immunogen for anti-ZFP36L2 antibody: synthetic peptide directed towards the N terminal of human ZFP36L2
Sequence MSTTLLSAFYDVDFLCKTEKSLANLNLNNMLDKKAVGTPV AAAPSSGFAP
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-ZFP36L2 antibody concentration is 1 mg/ml.
Description ZFP36L2 is a member of the TIS11 family of early response genes. Family members are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear transcription factor most likely functions in regulating the response to growth factors.This gene is a member of the TIS11 family of early response genes. Family members are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear transcription factor most likely functions in regulating the response to growth factors.
Characteristics Antigen Size: 494 amino acids
Molecular Weight 51kDa

Application Details

Application Notes WB Suggested Anti-ZFP36L2 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Hudson, Martinez-Yamout, Dyson et al.: "Recognition of the mRNA AU-rich element by the zinc finger domain of TIS11d." in: Nature structural & molecular biology, Vol. 11, Issue 3, pp. 257-64, 2004 (PubMed).

Alternatives

Alternatives for antigen "Zinc Finger Protein 36, C3H Type-Like 2 (ZFP36L2)", type "Antibodies"
Hosts Rabbit (28), Goat (1)
Reactivities Human (29), Mouse (Murine) (22), Rat (Rattus) (22), Dog (Canine) (19), Pig (Porcine) (17), Cow (Bovine) (1)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (14), ELISA (11), Immunohistochemistry (IHC) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes N-Term (2), C-Term (1), Internal Region (1), Internal Region,AA 165-193 (1)