Apoptosis Antagonizing Transcription Factor (AATF) (N-Term) antibody

Details for Product No. ABIN183737
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DED, CHE1, CHE-1, 4933415H02Rik, 5830465M17Rik, Che-1, Trb, Ded, AATF, ded, che1, che-1, cb109, sb:cb109, wu:fc13d05, zgc:162071
Epitope
N-Term
(11), (6), (4), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human, Chicken
(59), (33), (25), (13), (12), (12), (2), (1), (1)
Host
Rabbit
(49), (12)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(47), (30), (15), (13), (10), (7), (2), (2), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN183737
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human AATF
Sequence MAGPQPLALQLEQLLNPRPSEADPEADPEEATAARVIDRF DEGEDGEGDF
Predicted Reactivity Human : 100 %, Bovine : 90 %, Dog : 90 %, Horse : 90 %, Mouse : 90 %, Rabbit : 90 %, Rat : 90 %, Chicken : 90 %, Guinea pig : 80 %
Characteristics This is a rabbit polyclonal antibody against AATF. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name AATF
Background The AATF is a protein that was identified on the basis of its interaction with MAP3K12/DLK, a protein kinase known to be involved in the induction of cell apoptosis. AATF contains a leucine zipper, which is a characteristic motif of transcription factors, and was shown to exhibit strong transactivation activity when fused to Gal4 DNA binding domain. Overexpression of AATF interfered with MAP3K12 induced apoptosis.The protein encoded by this gene was identified on the basis of its interaction with MAP3K12/DLK, a protein kinase known to be involved in the induction of cell apoptosis. This gene product contains a leucine zipper, which is a characteristic motif of transcription factors, and was shown to exhibit strong transactivation activity when fused to Gal4 DNA binding domain. Overexpression of this gene interfered with MAP3K12 induced apoptosis.
Molecular Weight 63 kDa
Gene ID 26574
NCBI Accession NM_012138, NP_036270
UniProt Q9NY61
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 560 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Apoptosis Antagonizing Transcription Factor (AATF) (N-Term) antibody WB Suggested Anti-AATF Antibody Titration: 5.0ug/ml
ELISA Titer: 1:312500
Positive Control: Daudi cell lysate
Background publications Lehner, Sanderson: "A protein interaction framework for human mRNA degradation." in: Genome research, Vol. 14, Issue 7, pp. 1315-23, 2004 (PubMed).

Hosts (49), (12)
Reactivities (59), (33), (25), (13), (12), (12), (2), (1), (1)
Applications (47), (30), (15), (13), (10), (7), (2), (2), (1), (1), (1)
Conjugates (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (11), (6), (4), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top