Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183737

Apoptosis Antagonizing Transcription Factor (AATF) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DED, CHE1, CHE-1, 4933415H02Rik, 5830465M17Rik, Che-1, Trb, Ded, AATF, ded, che1, che-1, cb109, sb:cb109, wu:fc13d05, zgc:162071
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183737
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-AATF antibody: synthetic peptide directed towards the N terminal of human AATF
Sequence MAGPQPLALQLEQLLNPRPSEADPEADPEEATAARVIDRF DEGEDGEGDF
Predicted Reactivity Human : 100%, Bovine : 92%, Dog : 92%, Horse : 92%, Mouse : 92%, Rabbit : 92%, Rat : 92%, Chicken : 90%, Guinea pig : 85%
Characteristics This is a rabbit polyclonal antibody against AATF. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name AATF
Background The AATF is a protein that was identified on the basis of its interaction with MAP3K12/DLK, a protein kinase known to be involved in the induction of cell apoptosis. AATF contains a leucine zipper, which is a characteristic motif of transcription factors, and was shown to exhibit strong transactivation activity when fused to Gal4 DNA binding domain. Overexpression of AATF interfered with MAP3K12 induced apoptosis.The protein encoded by this gene was identified on the basis of its interaction with MAP3K12/DLK, a protein kinase known to be involved in the induction of cell apoptosis. This gene product contains a leucine zipper, which is a characteristic motif of transcription factors, and was shown to exhibit strong transactivation activity when fused to Gal4 DNA binding domain. Overexpression of this gene interfered with MAP3K12 induced apoptosis.
Molecular Weight 63kDa
Gene ID 26574
NCBI Accession NP_036270, NM_012138
UniProt Q9NY61
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-AATF antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Lehner, Sanderson: "A protein interaction framework for human mRNA degradation." in: Genome research, Vol. 14, Issue 7, pp. 1315-23, 2004 (PubMed).

Alternatives for antigen "Apoptosis Antagonizing Transcription Factor (AATF)", type "Antibodies"
Hosts (48), (12)
Reactivities (59), (30), (22), (13), (12), (12), (2), (1), (1)
Applications (45), (28), (14), (12), (10), (7), (5), (2), (1), (1)
Conjugates (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (11), (5), (4), (1), (1), (1)
Beacon