Did you know that you can buy products from over 140 different suppliers from us?

Kelch-Like ECH-Associated Protein 1 (KEAP1) (C-Term) antibody

Details for Product No. ABIN183745
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms INrf2, KLHL19, INRF2, mKIAA0132, Inrf2, fb36f11, keap1, wu:fb36f11, klhl19, KEAP1
Epitope
C-Term
(22), (8), (6), (4), (3), (2)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Pig (Porcine), Xenopus laevis, Human
(67), (32), (27), (16), (15), (15), (2), (1)
Host
Rabbit
(48), (14), (4)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(58), (33), (25), (17), (11), (10), (9), (5), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN183745
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human KEAP1
Sequence HTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVTMEPCR KQIDQQNCTC
Predicted Reactivity Bovine : 100 %, Guinea pig : 100 %, Human : 100 %, Pig : 100 %, Rabbit : 100 %, Dog : 90 %, Mouse : 90 %, Rat : 90 %, Horse : 80 %, African clawed frog : 80 %
Characteristics This is a rabbit polyclonal antibody against KEAP1. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name KEAP1
Background KEAP1 contains KELCH-1 like domains, as well as a BTB/POZ domain. Kelch-like ECH-associated protein 1 interacts with NF-E2-related factor 2 in a redox-sensitive manner and the dissociation of the proteins in the cytoplasm is followed by transportation of NF-E2-related factor 2 to the nucleus. This interaction results in the expression of the catalytic subunit of gamma-glutamylcysteine synthetase.This gene encodes a protein containing KELCH-1 like domains, as well as a BTB/POZ domain. Kelch-like ECH-associated protein 1 interacts with NF-E2-related factor 2 in a redox-sensitive manner and the dissociation of the proteins in the cytoplasm is followed by transportation of NF-E2-related factor 2 to the nucleus. This interaction results in the expression of the catalytic subunit of gamma-glutamylcysteine synthetase. Two alternatively spliced transcript variants encoding the same isoform have been found for this gene.
Molecular Weight 70 kDa
Gene ID 9817
NCBI Accession NM_203500, NP_987096
UniProt Q14145
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 624 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Kelch-Like ECH-Associated Protein 1 (KEAP1) (C-Term) antibody anti-Kelch-Like ECH-Associated Protein 1 (KEAP1) (C-Term) antibody
Background publications Padmanabhan, Tong, Ohta et al.: "Structural basis for defects of Keap1 activity provoked by its point mutations in lung cancer." in: Molecular cell, Vol. 21, Issue 5, pp. 689-700, 2006 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183745
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top