Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183745

Kelch-Like ECH-Associated Protein 1 (KEAP1) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms INrf2, KLHL19, INRF2, mKIAA0132, Inrf2, fb36f11, keap1, wu:fb36f11, klhl19, KEAP1
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Pig (Porcine), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN183745
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-KEAP1 antibody: synthetic peptide directed towards the C terminal of human KEAP1
Sequence HTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVTMEPCR KQIDQQNCTC
Predicted Reactivity Bovine : 100%, Guinea pig : 100%, Human : 100%, Pig : 100%, Rabbit : 100%, Dog : 92%, Mouse : 92%, Rat : 92%, Horse : 85%, African clawed frog : 84%
Characteristics This is a rabbit polyclonal antibody against KEAP1. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name KEAP1
Background KEAP1 contains KELCH-1 like domains, as well as a BTB/POZ domain. Kelch-like ECH-associated protein 1 interacts with NF-E2-related factor 2 in a redox-sensitive manner and the dissociation of the proteins in the cytoplasm is followed by transportation of NF-E2-related factor 2 to the nucleus. This interaction results in the expression of the catalytic subunit of gamma-glutamylcysteine synthetase.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.This gene encodes a protein containing KELCH-1 like domains, as well as a BTB/POZ domain. Kelch-like ECH-associated protein 1 interacts with NF-E2-related factor 2 in a redox-sensitive manner and the dissociation of the proteins in the cytoplasm is followed by transportation of NF-E2-related factor 2 to the nucleus. This interaction results in the expression of the catalytic subunit of gamma-glutamylcysteine synthetase. Two alternatively spliced transcript variants encoding the same isoform have been found for this gene.
Molecular Weight 70kDa
Gene ID 9817
NCBI Accession NP_987096, NM_203500
UniProt Q14145
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-KEAP1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Padmanabhan, Tong, Ohta et al.: "Structural basis for defects of Keap1 activity provoked by its point mutations in lung cancer." in: Molecular cell, Vol. 21, Issue 5, pp. 689-700, 2006 (PubMed).

Alternatives for antigen "Kelch-Like ECH-Associated Protein 1 (KEAP1)", type "Antibodies"
Hosts (38), (14), (4)
Reactivities (57), (31), (27), (16), (15), (15), (2), (1)
Applications (48), (20), (19), (11), (10), (9), (7), (4), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (14), (6), (4), (4), (3), (2), (2)
Beacon