Pogo Transposable Element with ZNF Domain (POGZ) (N-Term) antibody

Details for Product No. ABIN183768
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms ZNF280E, ZNF635, ZNF635m, AU015913, AU044539, 9530006B08Rik, POGZ
Epitope
N-Term
(5), (2), (2), (1), (1)
Reactivity
Rabbit, Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
(13), (4), (4), (4), (3), (3), (3), (2), (1), (1), (1)
Host
Rabbit
(13), (2)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(15), (5), (2), (2), (2)
Pubmed 1 reference available
Catalog no. ABIN183768
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human POGZ
Sequence EELEPWQKISDVIEDSVVEDYNSVDKTTTVSVSQQPVSAP VPIAAHASVA
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against POGZ. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name POGZ
Background POGZ appears to be a zinc finger protein containing a transposase domain at the C-terminus. This protein was found to interact with the transcription factor SP1 in a yeast two-hybrid systemThe protein encoded by this gene appears to be a zinc finger protein containing a transposase domain at the C-terminus. This protein was found to interact with the transcription factor SP1 in a yeast two-hybrid system. At least three alternatively spliced transcript variants encoding distinct isoforms have been observed.
Molecular Weight 155 kDa
Gene ID 23126
NCBI Accession NM_015100, NP_055915
UniProt Q7Z3K3
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 1410 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Pogo Transposable Element with ZNF Domain (POGZ) (N-Term) antibody anti-Pogo Transposable Element with ZNF Domain (POGZ) (N-Term) antibody
anti-Pogo Transposable Element with ZNF Domain (POGZ) (N-Term) antibody (2) anti-Pogo Transposable Element with ZNF Domain (POGZ) (N-Term) antibody (Image 2)
Background publications Beausoleil, Jedrychowski, Schwartz et al.: "Large-scale characterization of HeLa cell nuclear phosphoproteins." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 101, Issue 33, pp. 12130-5, 2004 (PubMed).

Hosts (13), (2)
Reactivities (13), (4), (4), (4), (3), (3), (3), (2), (1), (1), (1)
Applications (15), (5), (2), (2), (2)
Epitopes (5), (2), (2), (1), (1)
back to top