Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger Protein 777 (ZNF777) (C-Term) antibody

Details for Product No. ABIN183771
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2500002G23Rik, ZNF777, RGD1566056, Znf777
Epitope
C-Term
(2), (2), (1), (1), (1), (1)
Reactivity
Human
(8), (2), (2), (2), (1), (1)
Host
Rabbit
(7), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(8), (2), (2), (1), (1), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183771
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human ZNF777
Sequence GGGRGPGEPFRAVNFLDNKMDETNQHGGRDLAAGHSEGRC RAHLVGDRTL
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against ZNF777. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF777
Background The function remains unknown.
Molecular Weight 58 kDa
Gene ID 27153
NCBI Accession NM_015694
UniProt Q8N2J5
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 524 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 777 (ZNF777) (C-Term) antibody WB Suggested Anti-ZNF777 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
Product cited in: Nagase, Ishikawa, Kikuno et al.: "Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." in: DNA research : an international journal for rapid publication of reports on genes and genomes, Vol. 6, Issue 5, pp. 337-45, 2000 (PubMed).

Validation Images
back to top