Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183771

Zinc Finger Protein 777 (ZNF777) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RGD1566056, Znf777, 2500002G23Rik, ZNF777
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183771
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF777 antibody: synthetic peptide directed towards the C terminal of human ZNF777
Sequence GGGRGPGEPFRAVNFLDNKMDETNQHGGRDLAAGHSEGRC RAHLVGDRTL
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against ZNF777. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF777
Background The function remains unknown.
Molecular Weight 58kDa
Gene ID 27153
NCBI Accession EAL24432, NM_015694
UniProt Q8N2J5
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF777 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Nagase, Ishikawa, Kikuno et al.: "Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." in: DNA research : an international journal for rapid publication of reports on genes and genomes, Vol. 6, Issue 5, pp. 337-45, 2000 (PubMed).

Alternatives for antigen "Zinc Finger Protein 777 (ZNF777)", type "Antibodies"
Hosts (7), (2)
Reactivities (8), (2), (2), (2), (1), (1)
Applications (8), (2), (2), (2), (1), (1), (1), (1)
Epitopes (2), (2), (1), (1), (1)
Beacon