Did you know that you can buy products from over 140 different suppliers from us?

Hypoxia Inducible Factor 1, alpha Subunit Inhibitor (HIF1AN) (N-Term) antibody

Details for Product No. ABIN183780
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms FIH1, 2310046M24Rik, A830014H24Rik, cb728, id:ibd5139, HIF-1a, HIF1a, hif-1a, hif1a
Epitope
N-Term
(16), (13), (3), (3), (2), (2), (2), (1)
Reactivity
Human
(85), (28), (26), (15), (15), (12), (12), (2), (2)
Host
Rabbit
(55), (29)
Clonality
Polyclonal
Conjugate
Un-conjugated
(4), (4), (3), (3), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(72), (28), (21), (18), (11), (11), (10), (2), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN183780
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human HIF1AN
Sequence MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTR PIPRLSQSDP
Predicted Reactivity Human : 92 %, Horse : 82 %, Rabbit : 82 %
Characteristics This is a rabbit polyclonal antibody against HIF1AN. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name HIF1AN
Background HIF1AN is a co-repressor that interacts with hypoxia-inducible factor 1 (HIF-1) alpha and the von Hippel-Lindau tumor suppressor protein to mediate repression of HIF-1 transcriptional activity.
Molecular Weight 40 kDa
Gene ID 55662
NCBI Accession NM_017902, NP_060372
UniProt Q9NWT6
Research Area Cancer, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 349 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Hypoxia Inducible Factor 1, alpha Subunit Inhibitor (HIF1AN) (N-Term) antibody WB Suggested Anti-HIF1AN Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
Background publications Linke, Stojkoski, Kewley et al.: "Substrate requirements of the oxygen-sensing asparaginyl hydroxylase factor-inhibiting hypoxia-inducible factor." in: The Journal of biological chemistry, Vol. 279, Issue 14, pp. 14391-7, 2004 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183780
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top