Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183787

Kelch-Like 26 (Drosophila) (KLHL26) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C630013N10Rik, Klkl26, RGD1312034, si:ch211-255d18.7, wu:fi20e10, wu:fi28a03, zgc:153248
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183787
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-KLHL26 antibody: synthetic peptide directed towards the C terminal of human KLHL26
Sequence EAGCCLLERKIYIVGGYNWRLNNVTGIVQVYNTDTDEWER DLHFPESFAG
Predicted Reactivity Rabbit : 100%, Bovine : 92%, Chicken : 92%, Dog : 92%, Guinea pig : 92%, Horse : 92%, Mouse : 92%, Pig : 92%, Rat : 92%, Zebrafish : 92%
Characteristics This is a rabbit polyclonal antibody against KLHL26. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name KLHL26
Background The function of KLHL26 remains unknown.
Molecular Weight 68kDa
Gene ID 55295
NCBI Accession NP_060786, NM_018316
UniProt Q53HC5
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-KLHL26 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Suzuki, Yoshitomo-Nakagawa, Maruyama et al.: "Construction and characterization of a full length-enriched and a 5'-end-enriched cDNA library." in: Gene, Vol. 200, Issue 1-2, pp. 149-56, 1997 (PubMed).

Alternatives for antigen "Kelch-Like 26 (Drosophila) (KLHL26)", type "Antibodies"
Hosts (18)
Reactivities (17), (14), (12), (1), (1)
Applications (9), (9), (2), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (1), (1), (1)
Beacon