Kelch-Like 26 (Drosophila) (KLHL26) (C-Term) antibody

Details for Product No. ABIN183787
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms C630013N10Rik, Klkl26, RGD1312034, si:ch211-255d18.7, wu:fi20e10, wu:fi28a03, zgc:153248
Epitope
C-Term
(4), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
(17), (14), (12), (1), (1)
Host
Rabbit
(18)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(9), (9), (2), (2)
Pubmed 1 reference available
Catalog no. ABIN183787
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human KLHL26
Sequence EAGCCLLERKIYIVGGYNWRLNNVTGIVQVYNTDTDEWER DLHFPESFAG
Predicted Reactivity Rabbit : 100 %, Bovine : 90 %, Chicken : 90 %, Dog : 90 %, Guinea pig : 90 %, Horse : 90 %, Mouse : 90 %, Pig : 90 %, Rat : 90 %, Zebrafish : 90 %
Characteristics This is a rabbit polyclonal antibody against KLHL26. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name KLHL26
Background The function of KLHL26 remains unknown.
Molecular Weight 68 kDa
Gene ID 55295
NCBI Accession NM_018316, NP_060786
UniProt Q53HC5
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 615 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Kelch-Like 26 (Drosophila) (KLHL26) (C-Term) antibody WB Suggested Anti-KLHL26 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate
Product cited in: Suzuki, Yoshitomo-Nakagawa, Maruyama et al.: "Construction and characterization of a full length-enriched and a 5'-end-enriched cDNA library." in: Gene, Vol. 200, Issue 1-2, pp. 149-56, 1997 (PubMed).

Hosts (18)
Reactivities (17), (14), (12), (1), (1)
Applications (9), (9), (2), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (1), (1), (1)
back to top