Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183829

MYC Induced Nuclear Antigen (MINA) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MDIG, MINA53, NO52, ROX, AI449204, 1810047J07Rik, 2410057H13Rik, 3830408E23Rik, Mina53, MINA, mina, MGC83527, DKFZp459K0725
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN183829
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MINA antibody: synthetic peptide directed towards the N terminal of human MINA
Sequence MPKKAKPTGSGKEEGPAPCKQMKLEAAGGPSALNFDSPSS LFESLISPIK
Predicted Reactivity Human : 100%, Horse : 78%
Characteristics This is a rabbit polyclonal antibody against MINA. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name MINA
Background MINA is a protein with a molecular weight of 53 kDa, which is localized in the nucleus and with part of the protein concentrated in the nucleolus. It is a direct target gene of Myc and is involved in mammalian cell proliferation.
Molecular Weight 32kDa
Gene ID 84864
NCBI Accession NP_694822, NM_153182
UniProt Q8IUF6
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MINA antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Zhang, Lu, Yuan et al.: "The Human mineral dust-induced gene, mdig, is a cell growth regulating gene associated with lung cancer." in: Oncogene, Vol. 24, Issue 31, pp. 4873-82, 2005 (PubMed).

Alternatives for antigen "MYC Induced Nuclear Antigen (MINA)", type "Antibodies"
Hosts (32), (1)
Reactivities (33), (12), (4), (2), (2), (1)
Applications (33), (15), (13), (5), (3), (1)
Epitopes (17), (7), (4), (2), (1), (1)
Beacon