MYC Induced Nuclear Antigen (MINA) (N-Term) antibody

Details for Product No. ABIN183829
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MDIG, MINA53, NO52, ROX, AI449204, 1810047J07Rik, 2410057H13Rik, 3830408E23Rik, Mina53, MINA, mina, MGC83527, DKFZp459K0725
Epitope
N-Term
(17), (5), (4), (2), (2)
Reactivity
Human
(34), (14), (5), (2), (2), (1)
Host
Rabbit
(32), (2)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(34), (15), (14), (5), (3), (2)
Pubmed 1 reference available
Catalog no. ABIN183829
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human MINA
Sequence MPKKAKPTGSGKEEGPAPCKQMKLEAAGGPSALNFDSPSS LFESLISPIK
Predicted Reactivity Human : 100 %, Horse : 70 %
Characteristics This is a rabbit polyclonal antibody against MINA. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name MINA
Background MINA is a protein with a molecular weight of 53 kDa, which is localized in the nucleus and with part of the protein concentrated in the nucleolus. It is a direct target gene of Myc and is involved in mammalian cell proliferation.
Molecular Weight 32 kDa
Gene ID 84864
NCBI Accession NM_153182, NP_694822
UniProt Q8IUF6
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 280 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-MYC Induced Nuclear Antigen (MINA) (N-Term) antibody anti-MYC Induced Nuclear Antigen (MINA) (N-Term) antibody
anti-MYC Induced Nuclear Antigen (MINA) (N-Term) antibody (2) anti-MYC Induced Nuclear Antigen (MINA) (N-Term) antibody (Image 2)
Background publications Zhang, Lu, Yuan et al.: "The Human mineral dust-induced gene, mdig, is a cell growth regulating gene associated with lung cancer." in: Oncogene, Vol. 24, Issue 31, pp. 4873-82, 2005 (PubMed).

Hosts (32), (2)
Reactivities (34), (14), (5), (2), (2), (1)
Applications (34), (15), (14), (5), (3), (2)
Epitopes (17), (5), (4), (2), (2)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top