Did you know that you can buy products from over 140 different suppliers from us?

Nucleus Accumbens Associated 1, BEN and BTB (POZ) Domain Containing (NACC1) (C-Term) antibody

Details for Product No. ABIN183842
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BEND8, BTBD14B, BTBD30, NAC-1, NAC1, NACC1, 2010001H03Rik, 4930511N13Rik, Btbd14b, Nac1, Nac-1, EIEE6, FEB3, FEB3A, FHM3, GEFSP2, HBSCI, Nav1.1, SCN1, SMEI
Epitope
C-Term
(5), (3), (2), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(41), (16), (16), (16), (14), (12)
Host
Rabbit
(23), (15), (5)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(33), (11), (10), (10), (9), (8), (7), (7)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183842
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human BTBD14B
Sequence WMPKVKVLKAEDDAYTTFISETGKIEPDMMGVEHGFETAS HEGEAGPSAE
Predicted Reactivity Human :100 %,   Bovine :90 %,   Dog :90 %,   Rat :90 %,   Mouse :90 %,  
Characteristics This is a rabbit polyclonal antibody against BTBD14B. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name BTBD14B
Background The function of the Anti-BTBD14B gene has not yet been determined
Molecular Weight 57 kDa
Gene ID 112939
NCBI Accession NM_052876, NP_443108
UniProt Q96RE7
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 527 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Nucleus Accumbens Associated 1, BEN and BTB (POZ) Domain Containing (NACC1) (C-Term) antibody WB Suggested Anti-BTBD14B Antibody Titration: 5.0ug/ml
Positive Control: HepG2 cell lysate
anti-Nucleus Accumbens Associated 1, BEN and BTB (POZ) Domain Containing (NACC1) (C-Term) antibody (2) anti-Nucleus Accumbens Associated 1, BEN and BTB (POZ) Domain Containing (NACC1) (C-Term) antibody (Image 2)
anti-Nucleus Accumbens Associated 1, BEN and BTB (POZ) Domain Containing (NACC1) (C-Term) antibody (3) anti-Nucleus Accumbens Associated 1, BEN and BTB (POZ) Domain Containing (NACC1) (C-Term) antibody (Image 3)
Background publications Beausoleil, Jedrychowski, Schwartz et al.: "Large-scale characterization of HeLa cell nuclear phosphoproteins." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 101, Issue 33, pp. 12130-5, 2004 (PubMed).

Validation Images
back to top