Aprataxin (APTX) (C-Term) antibody

Details for Product No. ABIN183871
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AOA, AOA1, AXA1, EAOH, EOAHA, FHA-HIT, AA388047, 2410016G21Rik, aptx, APTX, LOC100284636, APRATAXIN-like, T10O8.20, T10O8_20
Epitope
C-Term
(2), (2), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Dog (Canine), Xenopus laevis, Human, Chicken
(26), (14), (14), (14), (2), (1), (1)
Host
Rabbit
(23), (2), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(17), (10), (7), (5), (4), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN183871
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human APTX
Sequence VIEMVQEAGRVTVRDGMPELLKLPLRCHECQQLLPSIPQL KEHLRKHWTQ
Predicted Reactivity Bovine : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rat : 100 %, Chicken : 90 %, Horse : 90 %, Dog : 90 %, African clawed frog : 90 %
Characteristics This is a rabbit polyclonal antibody against APTX. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name APTX
Background APTX is a member of the histidine triad (HIT) superfamily, some of which have nucleotide-binding and diadenosine polyphosphate hydrolase activities. APTX may play a role in single-stranded DNA repair. Mutations in this gene have been associated with ataxia-ocular apraxia.This gene encodes a member of the histidine triad (HIT) superfamily, some of which have nucleotide-binding and diadenosine polyphosphate hydrolase activities. The encoded protein may play a role in single-stranded DNA repair. Mutations in this gene have been associated with ataxia-ocular apraxia. Multiple transcript variants encoding distinct isoforms have been identified for this gene, however, the full length nature of some variants has not been determined.This gene encodes a member of the histidine triad (HIT) superfamily, some of which have nucleotide-binding and diadenosine polyphosphate hydrolase activities. The encoded protein may play a role in single-stranded DNA repair. Mutations in this gene have been associated with ataxia-ocular apraxia. Multiple transcript variants encoding distinct isoforms have been identified for this gene, however, the full length nature of some variants has not been determined.
Molecular Weight 38 kDa
Gene ID 54840
NCBI Accession NM_175073, NP_778243
UniProt Q6JV85
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 342 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Aprataxin (APTX) (C-Term) antibody WB Suggested Anti-APTX Antibody Titration: 2.5ug/ml
ELISA Titer: 1:1562500
Positive Control: NCI-H226 cell lysate
anti-Aprataxin (APTX) (C-Term) antibody (2) anti-Aprataxin (APTX) (C-Term) antibody (Image 2)
Background publications Ahnesorg, Smith, Jackson: "XLF interacts with the XRCC4-DNA ligase IV complex to promote DNA nonhomologous end-joining." in: Cell, Vol. 124, Issue 2, pp. 301-13, 2006 (PubMed).

Hosts (23), (2), (1)
Reactivities (26), (14), (14), (14), (2), (1), (1)
Applications (17), (10), (7), (5), (4), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (2), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top