Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183884

Peroxisome Proliferator-Activated Receptor Gamma, Coactivator 1 alpha (PPARGC1A) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AVPGC-1ALPHA, LEM6, PGC1, PGC1A, PGC-1v, PPARGC1, PGC-1(alpha), A830037N07Rik, ENSMUSG00000079510, Gm11133, PGC-1, Pgc-1alpha, Pgc1, Pgco1, Ppargc1, PPARGC1A
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183884
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-Ppargc1a antibody: synthetic peptide directed towards the middle region of mouse Ppargc1a
Sequence QEIRAELNKHFGHPCQAVFDDKSDKTSELRDGDFSNEQFS KLPVFINSGL
Predicted Reactivity Mouse : 100%, Horse : 91%, Pig : 91%, Rabbit : 91%, Bovine : 85%, Goat : 85%, Dog : 83%, Human : 83%
Characteristics This is a rabbit polyclonal antibody against Ppargc1a. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name Ppargc1a
Background Ppargc1a is a transcriptional coactivator for steroid receptors and nuclear receptors. Ppargc1a greatly increases the transcriptional activity of PPARG and thyroid hormone receptor on the uncoupling protein promoter. Ppargc1a can regulate key mitochondrial genes that contribute to the program of adaptive thermogenesis.
Molecular Weight 90kDa
Gene ID 19017
NCBI Accession NP_032930, NM_008904
UniProt O70343
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-Ppargc1a antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Finck, Kelly: "PGC-1 coactivators: inducible regulators of energy metabolism in health and disease." in: The Journal of clinical investigation, Vol. 116, Issue 3, pp. 615-22, 2006 (PubMed).

Alternatives for antigen "Peroxisome Proliferator-Activated Receptor Gamma, Coactivator 1 alpha (PPARGC1A)", type "Antibodies"
Hosts (45), (27), (7)
Reactivities (70), (29), (25), (22), (13), (13), (13), (2), (2), (1)
Applications (61), (36), (12), (10), (3), (2), (1), (1), (1), (1)
Conjugates (3), (3), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (10), (6), (6), (4), (3), (3), (1), (1), (1), (1)
Beacon