Did you know that you can buy products from over 140 different suppliers from us?

Peroxisome Proliferator-Activated Receptor Gamma, Coactivator 1 alpha (PPARGC1A) (Middle Region) antibody

Details for Product No. ABIN183884
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PPARGC1A, PPARGC1, A830037N07Rik, ENSMUSG00000079510, Gm11133, PGC-1, PGC-1v, Pgc-1alpha, Pgc1, Pgco1, Ppargc1, PGC1, PGC1A, LEM6, PGC-1(alpha), AVPGC-1ALPHA
Epitope
Middle Region
(10), (6), (6), (4), (3), (2), (2), (2), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Dog (Canine), Human
(70), (26), (21), (17), (13), (13), (13), (1)
Host
Rabbit
(43), (30), (6)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(61), (37), (15), (10), (4), (4), (3), (3), (2), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183884
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of mouse Ppargc1a
Sequence QEIRAELNKHFGHPCQAVFDDKSDKTSELRDGDFSNEQFS KLPVFINSGL
Predicted Reactivity Mouse : 100 %, Horse : 90 %, Pig : 90 %, Rabbit : 90 %, Bovine : 80 %, Goat : 80 %, Dog : 80 %, Human : 80 %
Characteristics This is a rabbit polyclonal antibody against Ppargc1a. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name Ppargc1a
Background Ppargc1a is a transcriptional coactivator for steroid receptors and nuclear receptors. Ppargc1a greatly increases the transcriptional activity of PPARG and thyroid hormone receptor on the uncoupling protein promoter. Ppargc1a can regulate key mitochondrial genes that contribute to the program of adaptive thermogenesis.
Molecular Weight 90 kDa
Gene ID 19017
NCBI Accession NM_008904, NP_032930
UniProt O70343
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 797 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Peroxisome Proliferator-Activated Receptor Gamma, Coactivator 1 alpha (PPARGC1A) (Middle Region) antibody WB Suggested Anti-Ppargc1a Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: SP2/0 cell lysate
anti-Peroxisome Proliferator-Activated Receptor Gamma, Coactivator 1 alpha (PPARGC1A) (Middle Region) antibody (2) Ppargc1a Antibody - middle region (ARP40129_P050) validated by WB using Transfected Melanoma Cell at 1:1000.
Background publications Finck, Kelly: "PGC-1 coactivators: inducible regulators of energy metabolism in health and disease." in: The Journal of clinical investigation, Vol. 116, Issue 3, pp. 615-22, 2006 (PubMed).

Validation Images
back to top