Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Peroxisome Proliferator-Activated Receptor Gamma, Coactivator 1 alpha (PPARGC1A) antibody

Antigen

Peroxisome Proliferator-Activated Receptor Gamma, Coactivator 1 alpha (PPARGC1A)
Synonyms AVPGC-1ALPHA, PPARGC1A, PPARGC1
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Cow (Bovine), Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Human
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN183884
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Peroxisome Proliferator-Activated Receptor Gamma, Coactivator 1 alpha (PPARGC1A) antibody

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name PPARGC1A / PGC1A
Gene ID Ppargc1a
UniProt O70343
Immunogen The immunogen for anti-Ppargc1a antibody: synthetic peptide directed towards the middle region of mouse Ppargc1a
Sequence QEIRAELNKHFGHPCQAVFDDKSDKTSELRDGDFSNEQFS KLPVFINSGL
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-Ppargc1a antibody concentration is 1 mg/ml.
Description Ppargc1a is a transcriptional coactivator for steroid receptors and nuclear receptors. Ppargc1a greatly increases the transcriptional activity of PPARG and thyroid hormone receptor on the uncoupling protein promoter. Ppargc1a can regulate key mitochondrial genes that contribute to the program of adaptive thermogenesis.
Characteristics Antigen Size: 797 amino acids
Molecular Weight 90kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-Ppargc1a Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: SP2/0 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Product Finck, Kelly: "PGC-1 coactivators: inducible regulators of energy metabolism in health and disease." in: The Journal of clinical investigation, Vol. 116, Issue 3, pp. 615-22, 2006 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "Peroxisome Proliferator-Activated Receptor Gamma, Coactivator 1 alpha (PPARGC1A)", type "Antibodies"
Hosts Rabbit (31), Mouse (13), Goat (5)
Reactivities Human (41), Mouse (Murine) (25), Dog (Canine) (21), Rat (Rattus) (21), Chicken (19), Cow (Bovine) (19), Pig (Porcine) (19), Horse (Equine) (18), Xenopus laevis (1)
Applications Western Blotting (WB) (28), ELISA (20), Immunofluorescence (IF) (15), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (8), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Dot Blot (Dot) (1), Immunocytochemistry (ICC) (1), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (IHC) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes N-Term (3), AA 75-90 (2), C-Term (2), Internal Region (2), AA 250-300 (1), AA 777-797 (1)