Did you know that you can buy products from over 140 different suppliers from us?

Methyl-CpG Binding Domain Protein 2 (MBD2) (Middle Region) antibody

Details for Product No. ABIN183889
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MBD2, DMTase, NY-CO-41, MBD2a, wu:fa97f06, zgc:111862
Epitope
Middle Region
(14), (13), (9), (3), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Dog (Canine), Human, Chicken
(62), (15), (10), (4)
Host
Rabbit
(58), (7), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (2), (2)
Application
Western Blotting (WB)
(61), (37), (10), (8), (8), (7), (1)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183889
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human MBD2
Sequence DCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSK PQLARYLGNT
Predicted Reactivity Chicken : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, African clawed frog : 80 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against MBD2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name MBD2
Background MBD2 belongs to a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MBD2 can also repress transcription from methylated gene promoters. MBD2 may function as a mediator of the biological consequences of the methylation signal.It is also reported that the MBD2 functions as a demethylase to activate transcription, as DNA methylation causes gene silencing.DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. The protein encoded by this gene may function as a mediator of the biological consequences of the methylation signal. It is also reported that the this protein functions as a demethylase to activate transcription, as DNA methylation causes gene silencing.
Molecular Weight 32 kDa
Gene ID 8932
NCBI Accession NM_015832, NP_056647
UniProt Q9UBB5-3
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 302 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Methyl-CpG Binding Domain Protein 2 (MBD2) (Middle Region) antibody WB Suggested Anti-MBD2 Antibody Titration: 0.625ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate
anti-Methyl-CpG Binding Domain Protein 2 (MBD2) (Middle Region) antibody (2) WB Suggested Anti-MBD2
Antibody Titration: 0.625 µg/mL ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate
Background publications Le Guezennec, Vermeulen, Brinkman et al.: "MBD2/NuRD and MBD3/NuRD, two distinct complexes with different biochemical and functional properties." in: Molecular and cellular biology, Vol. 26, Issue 3, pp. 843-51, 2006 (PubMed).

Validation Images
back to top