Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183889

Methyl-CpG Binding Domain Protein 2 (MBD2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DMTase, NY-CO-41, MBD2a, wu:fa97f06, zgc:111862, MBD2
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183889
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MBD2 antibody: synthetic peptide directed towards the middle region of human MBD2
Sequence DCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSK PQLARYLGNT
Predicted Reactivity Chicken : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, African clawed frog : 85%, Zebrafish : 85%
Characteristics This is a rabbit polyclonal antibody against MBD2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name MBD2
Background MBD2 belongs to a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MBD2 can also repress transcription from methylated gene promoters. MBD2 may function as a mediator of the biological consequences of the methylation signal.It is also reported that the MBD2 functions as a demethylase to activate transcription, as DNA methylation causes gene silencing.DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. The protein encoded by this gene may function as a mediator of the biological consequences of the methylation signal. It is also reported that the this protein functions as a demethylase to activate transcription, as DNA methylation causes gene silencing.
Molecular Weight 32kDa
Gene ID 8932
NCBI Accession NP_056647, NM_015832
UniProt Q9UBB5-3
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MBD2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Le Guezennec, Vermeulen, Brinkman et al.: "MBD2/NuRD and MBD3/NuRD, two distinct complexes with different biochemical and functional properties." in: Molecular and cellular biology, Vol. 26, Issue 3, pp. 843-51, 2006 (PubMed).

Alternatives for antigen "Methyl-CpG Binding Domain Protein 2 (MBD2)", type "Antibodies"
Hosts (42), (8), (2), (2)
Reactivities (49), (17), (9), (5), (1), (1), (1), (1), (1), (1)
Applications (48), (24), (10), (8), (6), (4), (1), (1), (1), (1)
Epitopes (9), (7), (4), (2), (2), (2), (1), (1), (1), (1), (1)
Beacon