Did you know that you can buy products from over 140 different suppliers from us?

Ribosomal Protein L9 (RPL9) (C-Term) antibody

Details for Product No. ABIN183899
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms L9, NPC-A-16, ab02c03, fa93a01, mg:ab02c03, wu:fa93a01, zgc:103730, CG6141, Dmel\\CG6141, M(2)32D, Rp L9, Rpl9, anon-EST:fe3A6, anon-WO0153538.25, anon-WO0153538.26, anon-WO0153538.27, rpL9
Epitope
C-Term
(13), (8), (7), (6), (6), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human
(28), (13), (4), (2), (1), (1), (1), (1)
Host
Rabbit
(30), (11)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (3), (3), (3), (3)
Application
Western Blotting (WB)
(39), (25), (6), (6), (4), (3)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN183899
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human RPL9
Sequence ELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVS EKGTVQQADE
Predicted Reactivity Dog : 100 %, Human : 100 %, Mouse : 100 %, Rat : 90 %, African clawed frog : 80 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against RPL9. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name RPL9
Background RPL9 is a ribosomal protein that is a component of the 60S subunit. RPL9 belongs to the L6P family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L6P family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Two alternatively spliced transcript variants encoding the same protein have been found for this gene.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L6P family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Two alternatively spliced transcript variants encoding the same protein have been found for this gene.
Molecular Weight 21 kDa
Gene ID 6133
NCBI Accession NM_000661, NP_000652
UniProt P32969
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 192 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Ribosomal Protein L9 (RPL9) (C-Term) antibody WB Suggested Anti-RPL9 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate
Background publications Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183899
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top