Did you know that you can buy products from over 140 different suppliers from us?

Obg-Like ATPase 1 (OLA1) (C-Term) antibody

Details for Product No. ABIN183915
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MGC79585, PTD004, GTPBP9, DOC45, GBP45, GTBP9, 2510025G09Rik, 2810405J23Rik, 2810409H07Rik, Gtpbp9, RGD1307982, fe36h01, wu:fc66b09, wu:fe36h01, wu:fk82a02, zgc:55768, zgc:85691
Epitope
C-Term
(15), (8), (2), (1), (1), (1)
Reactivity
Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Fruit Fly (Drosophila melanogaster), Zebrafish, Chicken, Xenopus laevis
(36), (19), (19), (15), (15), (2), (1), (1), (1)
Host
Rabbit
(40)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(31), (11), (10), (9), (5), (4), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183915
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human GTPBP9
Sequence QAAGKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKY RQQGRNYIVE
Cross-Reactivity Cow (Bovine), Chicken, Fruit Fly (Drosophila melanogaster), Human, Mouse (Murine), Rat (Rattus)
Predicted Reactivity Rat :100 %,   Bovine :100 %,   Mouse :100 %,   Green puffer :100 %,   Sumatran orangutan :100 %,   Chicken :100 %,   Western clawed frog :100 %,   African malaria mosquito :100 %,   Zebrafish :100 %,   African clawed frog :100 %,   Human :100 %,   Silk moth :100 %,   Harpegnathos saltator :100 %,   White-tufted-ear marmoset :100 %,   Filarial nematode worm :100 %,   Southern house mosquito :100 %,   Fruit fly :100 %,   Trichoplax reptans :100 %,   salmon louse :100 %,   Pea aphid :100 %,   Savannah tsetse fly :100 %,   Red flour beetle :100 %,   Eye worm :100 %,   Yellowfever mosquito :90 %,   Camponotus floridanus :90 %,   Florida lancelet :90 %,   Black-legged tick :90 %,   Atlantic salmon :90 %,   Chlamydomonas smithii :80 %,   Volvox carteri f. nagariensis :80 %,   Rainbow smelt :80 %,   Choanoflagellate :80 %,   Mouse-ear cress :70 %,   Ostreococcus tauri :70 %,   Spikemoss :70 %,   Arabidopsis lyrata subsp. lyrata :70 %,   Blood fluke :70 %,   Smut fungus :70 %,   Entamoeba histolytica :70 %,   Rice :70 %,  
Purification Affinity Purified
Alternative Name GTPBP9 / OLA1
Background GTPBP9 belongs to the GTP1/OBG family and the function remains unknown.
Molecular Weight 44 kDa
NCBI Accession NM_013341, NP_037473
UniProt Q9NTK5
Application Notes WB Suggested Anti-GTPBP9 Antibody Titration: 0.2-1 µg/mL
Positive Control: Jurkat cell lysate.
Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 396 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage 4 °C
Storage Comment Any unfrozen and/or unused material can be stored at 4 °C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -24 °C
Supplier Images
anti-Obg-Like ATPase 1 (OLA1) (C-Term) antibody WB Suggested Anti-GTPBP9 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
Background publications Wiemann, Weil, Wellenreuther et al.: "Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs." in: Genome research, Vol. 11, Issue 3, pp. 422-35, 2001 (PubMed).

Validation Images
back to top