Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183927

Retinoic Acid Receptor, alpha (RARA) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RAR, NR1B1, Nr1b1, RARalpha1, nr1b1, rara2a, RAR-ALPHA1, HS-RARa, rar-alpha
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183927
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RARA antibody: synthetic peptide directed towards the N terminal of human RARA
Sequence TPNPFLVVDFYNQNRACLLPEKGLPAPGPYSTPLRTPLWN GSNHSIETQS
Predicted Reactivity Human : 100%, Mouse : 92%, Rat : 92%
Characteristics This is a rabbit polyclonal antibody against RARA. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name RARA
Background RARA contains 1 nuclear receptor DNA-binding domain and belongs to the nuclear hormone receptor family, NR1 subfamily. It is a receptor for retinoic acid. This metabolite has profound effects on vertebrate development. Retinoic acid is a morphogen and is a powerful teratogen. This receptor controls cell function by directly regulating gene expression
Molecular Weight 50kDa
Gene ID 5914
NCBI Accession NP_001019980, NM_001024809
UniProt P10276-2
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RARA antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Srinivas, Xia, Moore et al.: "Akt phosphorylates and suppresses the transactivation of retinoic acid receptor alpha." in: The Biochemical journal, Vol. 395, Issue 3, pp. 653-62, 2006 (PubMed).

Alternatives for antigen "Retinoic Acid Receptor, alpha (RARA)", type "Antibodies"
Hosts (58), (26), (8)
Reactivities (88), (48), (40), (9), (8), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Applications (83), (50), (26), (18), (10), (8), (6), (2), (1), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (11), (11), (9), (9), (7), (3), (2), (2), (1), (1), (1), (1), (1), (1)
Beacon