Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183930

CUGBP, Elav-Like Family Member 2 (CELF2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
CUGBP2, BRUNOL3, ETR-3, ETR3, NAPOR, Brunol3, Cugbp2, Etr3, Napor, B230218O03, B230345P09Rik, C88023, CELF-2, CUG-BP2, D230046B21Rik, Etr-3, Napor-2, mETR-3, cb906, cugbp2, fj87b07, wu:fj87b07, brunol ... show more
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Cow (Bovine), Human, Zebrafish (Danio rerio), Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 2 references available
Catalog no. ABIN183930
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CUGBP2 antibody: synthetic peptide directed towards the N terminal of human CUGBP2
Sequence VYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHN IKTLPGMHHP
Predicted Reactivity Zebrafish : 92%
Characteristics This is a rabbit polyclonal antibody against CUGBP2. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name CUGBP2
Background Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation.Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Alternative splicing results in multiple transcript variants encoding different isoforms.
Molecular Weight 56kDa
Gene ID 10659
NCBI Accession NP_006552, NM_006561
UniProt Q96RQ6
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CUGBP2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Han, Cooper: "Identification of CELF splicing activation and repression domains in vivo." in: Nucleic acids research, Vol. 33, Issue 9, pp. 2769-80, 2005 (PubMed).

Han, Liu, Liu et al.: "Human Bex2 interacts with LMO2 and regulates the transcriptional activity of a novel DNA-binding complex." in: Nucleic acids research, Vol. 33, Issue 20, pp. 6555-65, 2005 (PubMed).

Alternatives for antigen "CUGBP, Elav-Like Family Member 2 (CELF2)", type "Antibodies"
Hosts (26)
Reactivities (21), (7), (4), (2), (2), (1), (1), (1)
Applications (26), (7), (4), (1), (1)
Epitopes (8), (5), (2), (1), (1), (1)
Beacon