Did you know that you can buy products from over 140 different suppliers from us?

Fibrillarin (FBL) (N-Term) antibody

Details for Product No. ABIN183938
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CG9888, Dmel\\CG9888, Fibri, GCR-6, GCR6, Pen59C5, fib, pen59C5, CG5725, Dmel\\CG5725, PANK, dPANK, dPANK/Fbl, FBL, MGC76139, FIB, FLRN, RNU3IP1, AL022665, wu:fb37g12, zgc:56145, zgc:77130
Epitope
N-Term
(4), (3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
(55), (26), (22), (14), (14), (14), (11), (3), (2), (2), (2), (2), (2), (2), (1), (1)
Host
Rabbit
(38), (31), (5)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(60), (25), (12), (11), (10), (9), (9), (7), (2), (2)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183938
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human FBL
Sequence GGGFHSGGNRGRGRGGKRGNQSGKNVMVEPHRHEGVFICR GKEDALVTKN
Predicted Reactivity Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 90 %, Bovine : 80 %
Characteristics This is a rabbit polyclonal antibody against FBL. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name FBL
Background FBL is a component of a nucleolar small nuclear ribonucleoprotein (snRNP) particle thought to participate in the first step in processing preribosomal RNA. It is associated with the U3, U8, and U13 small nuclear RNAs and is located in the dense fibrillar component (DFC) of the nucleolus. FBL contains an N-terminal repetitive domain that is rich in glycine and arginine residues, like fibrillarins in other species. Its central region resembles an RNA-binding domain and contains an RNP consensus sequence. Antisera from approximately 8 % of humans with the autoimmune disease scleroderma recognize fibrillarin.This gene product is a component of a nucleolar small nuclear ribonucleoprotein (snRNP) particle thought to participate in the first step in processing preribosomal RNA. It is associated with the U3, U8, and U13 small nuclear RNAs and is located in the dense fibrillar component (DFC) of the nucleolus. The encoded protein contains an N-terminal repetitive domain that is rich in glycine and arginine residues, like fibrillarins in other species. Its central region resembles an RNA-binding domain and contains an RNP consensus sequence. Antisera from approximately 8 % of humans with the autoimmune disease scleroderma recognize fibrillarin.
Molecular Weight 35 kDa
Gene ID 2091
NCBI Accession NM_001436, NP_001427
UniProt P22087
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 321 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Fibrillarin (FBL) (N-Term) antibody WB Suggested Anti-FBL Antibody Titration: 1.25ug/ml
ELISA Titer: 1:12500
Positive Control: Jurkat cell lysate
anti-Fibrillarin (FBL) (N-Term) antibody (2) anti-Fibrillarin (FBL) (N-Term) antibody (Image 2)
anti-Fibrillarin (FBL) (N-Term) antibody (3) WB Suggested Anti-FBL
Antibody Titration: 1.25 µg/mL ELISA Titer: 1:12500
Positive Control: Jurkat cell lysate
FBL is supported by BioGPS gene expression data to be expressed in Jurkat
Background publications Bouwmeester, Bauch, Ruffner et al.: "A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway...." in: Nature cell biology, Vol. 6, Issue 2, pp. 97-105, 2004 (PubMed).

Validation Images
back to top