Staufen, RNA Binding Protein, Homolog 1 (Drosophila) (STAU1) (N-Term) antibody

Details for Product No. ABIN183977
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms STAU, fi67e05, zgc:77271, wu:fi67e05, 5830401L18Rik, AW549911, C85792, Stau, Staufen1, XStau, XStau1, STAU1, DKFZp459A0124, CG5753, Dmel\\CG5753, Dmstau, Stauf, dStau, stau, Staufen, MGC145034
Epitope
N-Term
(9), (7), (4), (3), (1)
Reactivity
Rat (Rattus), Mouse (Murine), Cow (Bovine), Human
(37), (14), (13), (3), (2), (1), (1)
Host
Rabbit
(33), (8)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(40), (19), (8), (5), (5), (3), (2)
Pubmed 1 reference available
Catalog no. ABIN183977
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human STAU1
Sequence LSVGGQQFNGKGKTRQAAKHDAAAKALRILQNEPLPERLE VNGRESEEEN
Predicted Reactivity Bovine : 100 %, Horse : 100 %, Human : 100 %, Rabbit : 100 %, Rat : 100 %, Dog : 90 %, Guinea pig : 90 %, Mouse : 90 %
Characteristics This is a rabbit polyclonal antibody against STAU1. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name STAU1
Background STAU1(Staufen) is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. The human homologue of staufen encoded by STAU, in addition contains a microtubule- binding domain similar to that of microtubule-associated protein 1B, and binds tubulin. Staufen is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. The human homologue of staufen encoded by STAU, in addition contains a microtubule- binding domain similar to that of microtubule-associated protein 1B, and binds tubulin. The STAU gene product has been shown to be present in the cytoplasm in association with the rough endoplasmic reticulum (RER), implicating this protein in the transport of mRNA via the microtubule network to the RER, the site of translation. Five transcript variants resulting from alternative splicing of STAU gene and encoding three isoforms have been described. Three of these variants encode the same isoform, however, differ in their 5'UTR.
Molecular Weight 63 kDa
Gene ID 6780
NCBI Accession NM_017453, NP_059347
UniProt O95793
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 577 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Staufen, RNA Binding Protein, Homolog 1 (Drosophila) (STAU1) (N-Term) antibody WB Suggested Anti-STAU1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
anti-Staufen, RNA Binding Protein, Homolog 1 (Drosophila) (STAU1) (N-Term) antibody (2) anti-Staufen, RNA Binding Protein, Homolog 1 (Drosophila) (STAU1) (N-Term) antibody (Image 2)
Background publications Kim, Furic, Desgroseillers et al.: "Mammalian Staufen1 recruits Upf1 to specific mRNA 3'UTRs so as to elicit mRNA decay." in: Cell, Vol. 120, Issue 2, pp. 195-208, 2005 (PubMed).

Hosts (33), (8)
Reactivities (37), (14), (13), (3), (2), (1), (1)
Applications (40), (19), (8), (5), (5), (3), (2)
Epitopes (9), (7), (4), (3), (1)
back to top