Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183977

Staufen, RNA Binding Protein, Homolog 1 (Drosophila) (STAU1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms STAU, fi67e05, zgc:77271, wu:fi67e05, 5830401L18Rik, AW549911, C85792, Stau, Staufen1, XStau, XStau1, STAU1, DKFZp459A0124, CG5753, Dmel\\CG5753, Dmstau, Stauf, dStau, stau, Staufen, MGC145034
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN183977
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-STAU1 antibody: synthetic peptide directed towards the N terminal of human STAU1
Sequence LSVGGQQFNGKGKTRQAAKHDAAAKALRILQNEPLPERLE VNGRESEEEN
Predicted Reactivity Bovine : 100%, Horse : 100%, Human : 100%, Rabbit : 100%, Rat : 100%, Dog : 92%, Guinea pig : 92%, Mouse : 92%
Characteristics This is a rabbit polyclonal antibody against STAU1. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name STAU1
Background STAU1(Staufen) is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. The human homologue of staufen encoded by STAU, in addition contains a microtubule- binding domain similar to that of microtubule-associated protein 1B, and binds tubulin. Staufen is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. The human homologue of staufen encoded by STAU, in addition contains a microtubule- binding domain similar to that of microtubule-associated protein 1B, and binds tubulin. The STAU gene product has been shown to be present in the cytoplasm in association with the rough endoplasmic reticulum (RER), implicating this protein in the transport of mRNA via the microtubule network to the RER, the site of translation. Five transcript variants resulting from alternative splicing of STAU gene and encoding three isoforms have been described. Three of these variants encode the same isoform, however, differ in their 5'UTR.
Molecular Weight 63kDa
Gene ID 6780
NCBI Accession NP_059347, NM_017453
UniProt O95793
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-STAU1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Kim, Furic, Desgroseillers et al.: "Mammalian Staufen1 recruits Upf1 to specific mRNA 3'UTRs so as to elicit mRNA decay." in: Cell, Vol. 120, Issue 2, pp. 195-208, 2005 (PubMed).

Alternatives for antigen "Staufen, RNA Binding Protein, Homolog 1 (Drosophila) (STAU1)", type "Antibodies"
Hosts (25), (8)
Reactivities (29), (11), (10), (3), (2), (1), (1)
Applications (32), (16), (6), (5), (2), (1)
Epitopes (6), (6), (5), (2), (2), (1)
Beacon