Poly(rC) Binding Protein 2 (PCBP2) (Middle Region) antibody

Details for Product No. ABIN183983
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HNRNPE2, HNRPE2, hnRNP-E2, AW412548, Hnrpx, alphaCP-2, pcbp2
Epitope
Middle Region
(6), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
(29), (9), (9), (2), (2), (1), (1), (1), (1), (1)
Host
Rabbit
(20), (11)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(30), (12), (9), (6), (4), (4), (2), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN183983
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human PCBP2
Sequence VIFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEGPPLEAY TIQGQYAIPQ
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against PCBP2. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name PCBP2
Background PCBP2 appears to be multifunctional. It along with PCBP-1 and hnRNPK corresponds to the major cellular poly(rC)-binding proteins. This protein together with PCBP-1 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability. This gene and PCBP-1 has paralogues PCBP3 and PCBP4 which is thought to arose as a result of duplication events of entire genes.The protein encoded by this gene appears to be multifunctional. It along with PCBP-1 and hnRNPK corresponds to the major cellular poly(rC)-binding proteins. It contains three K-homologous (KH) domains which may be involved in RNA binding. This encoded protein together with PCBP-1 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability. This multiexon structural mRNA is thought to be retrotransposed to generate PCBP-1 intronless gene which has similar functions. This gene and PCBP-1 has paralogues PCBP3 and PCBP4 which is thought to arose as a result of duplication events of entire genes. It also has two processed pseudogenes PCBP2P1 and PCBP2P2. There are presently two alternatively spliced transcript variants described for this gene.
Molecular Weight 40 kDa
Gene ID 5094
NCBI Accession NM_005016, NP_005007
UniProt Q6IPF4
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 366 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Poly(rC) Binding Protein 2 (PCBP2) (Middle Region) antibody WB Suggested Anti-PCBP2 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate
anti-Poly(rC) Binding Protein 2 (PCBP2) (Middle Region) antibody (2) anti-Poly(rC) Binding Protein 2 (PCBP2) (Middle Region) antibody (Image 2)
Background publications Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).

Hosts (20), (11)
Reactivities (29), (9), (9), (2), (2), (1), (1), (1), (1), (1)
Applications (30), (12), (9), (6), (4), (4), (2), (2), (1)
Epitopes (6), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top