Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 21 (NUDT21) antibody

Antigen: Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 21 (NUDT21)

Synonyms: CPSF5, CFIM25, DKFZp686H1588, 25kDa, Cpsf5, AU014860, AW549947, 3110048P04Rik, 5730530J16Rik, Nudt21, MGC112766, MGC63966, zgc:63966, cpsf5, MGC84447, NUDT21, DKFZp469G0413

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish, Xenopus laevis, Chicken, Fruit Fly (Drosophila melanogaster)

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN184018

Additional Information

Alternative name: CPSF5

Gene ID: NUDT21

UniProt: O43809

Immunogen: The immunogen for anti-NUDT21 antibody: synthetic peptide directed towards the N terminal of human NUDT21

Sequence: TGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTK EPLYEKDSSV

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Fruit Fly (Drosophila melanogaster), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-NUDT21 antibody concentration is 1 mg/ml.

Description: NUDT21 is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors.The protein encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors. This gene encodes the 25kD subunit of the protein complex, which is composed of four polypeptides.

Characteristics: Antigen Size: 227 amino acids

Molecular Weight: 25kDa

Application Details

Application Notes: WB Suggested Anti-NUDT21 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-NUDT21 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate

anti-Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 21 (NUDT21) antibody (Image 2)

Publications

Product: Dettwiler, Aringhieri, Cardinale et al.: "Distinct sequence motifs within the 68-kDa subunit of cleavage factor Im mediate RNA binding, protein-protein interactions, and subcellular localization." in: The Journal of biological chemistry, Vol. 279, Issue 34, pp. 35788-97, 2004 (PubMed).