Did you know that you can buy products from over 140 different suppliers from us?

La Ribonucleoprotein Domain Family, Member 7 (LARP7) (C-Term) antibody

Details for Product No. ABIN184041
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ALAZS, PIP7S, D3Wsu161e, C330027G06Rik, fa10g04, zgc:56476, wu:fa10g04, LARP7
Epitope
C-Term
(12), (8), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
(19), (5), (4), (1), (1), (1)
Host
Rabbit
(24)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (1), (1), (1), (1)
Application
Western Blotting (WB)
(21), (10), (3), (2)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN184041
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human LARP7
Sequence HCWKLEILSGDHEQRYWQKILVDRQAKLNQPREKKRGTEK LITKAEKIRL
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 90 %, Pig : 80 %
Characteristics This is a rabbit polyclonal antibody against LARP7. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name LARP7
Background The function remains unknown.
Molecular Weight 39 kDa
Gene ID 51574
NCBI Accession NM_001267039
UniProt Q4G0J3
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 355 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-La Ribonucleoprotein Domain Family, Member 7 (LARP7) (C-Term) antibody WB Suggested Anti-LARP7 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate
Background publications Brandenberger, Wei, Zhang et al.: "Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation." in: Nature biotechnology, Vol. 22, Issue 6, pp. 707-16, 2004 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN184041
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top