Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN184041

La Ribonucleoprotein Domain Family, Member 7 (LARP7) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ALAZS, PIP7S, D3Wsu161e, C330027G06Rik, fa10g04, zgc:56476, wu:fa10g04, LARP7
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN184041
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-LARP7 antibody: synthetic peptide directed towards the C terminal of human LARP7
Sequence HCWKLEILSGDHEQRYWQKILVDRQAKLNQPREKKRGTEK LITKAEKIRL
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 92%, Pig : 85%
Characteristics This is a rabbit polyclonal antibody against LARP7. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name LARP7
Background The function remains unknown.
Molecular Weight 39kDa
Gene ID 51574
NCBI Accession EAX06285, NM_001267039
UniProt Q4G0J3
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-LARP7 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Brandenberger, Wei, Zhang et al.: "Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation." in: Nature biotechnology, Vol. 22, Issue 6, pp. 707-16, 2004 (PubMed).

Alternatives for antigen "La Ribonucleoprotein Domain Family, Member 7 (LARP7)", type "Antibodies"
Hosts (15)
Reactivities (10), (4), (3), (1), (1), (1)
Applications (12), (5), (2)
Conjugates (1), (1)
Epitopes (7), (2), (2), (1), (1)
Beacon