LSM2 Homolog, U6 Small Nuclear RNA Associated (S. Cerevisiae) (LSM2) (Middle Region) antibody

Details for Product No. ABIN184054
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms G7b, D17H6S56E-2, D17H6S56E2, Dmapl, Dmpkap, Sm-X5, SmX5, snRNP, C6orf28, G7B, YBL026W, lsm2, wu:fe48h10, zgc:101795, LSM2, 61.t00040, 18.m06211, 18.m06235
Epitope
Middle Region
(3), (2), (2), (2)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Pig (Porcine), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human
(10), (3), (3), (1), (1), (1)
Host
Rabbit
(5), (4), (2)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(9), (7), (4), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN184054
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human LSM2
Sequence TDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDA ARKEALQQKQ
Predicted Reactivity Bovine : 100 %, Goat : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rat : 100 %, African clawed frog : 90 %
Characteristics This is a rabbit polyclonal antibody against LSM2. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name LSM2
Background Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2, MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.
Molecular Weight 10 kDa
Gene ID 57819
NCBI Accession NM_021177, NP_067000
UniProt Q9Y333
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 95 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-LSM2 Homolog, U6 Small Nuclear RNA Associated (S. Cerevisiae) (LSM2) (Middle Region) antibody WB Suggested Anti-LSM2 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate
anti-LSM2 Homolog, U6 Small Nuclear RNA Associated (S. Cerevisiae) (LSM2) (Middle Region) antibody (2) anti-LSM2 Homolog, U6 Small Nuclear RNA Associated (S. Cerevisiae) (LSM2) (Middle Region) antibody (Image 2)
anti-LSM2 Homolog, U6 Small Nuclear RNA Associated (S. Cerevisiae) (LSM2) (Middle Region) antibody (3) anti-LSM2 Homolog, U6 Small Nuclear RNA Associated (S. Cerevisiae) (LSM2) (Middle Region) antibody (Image 3)
Background publications Lehner, Sanderson: "A protein interaction framework for human mRNA degradation." in: Genome research, Vol. 14, Issue 7, pp. 1315-23, 2004 (PubMed).

Hosts (5), (4), (2)
Reactivities (10), (3), (3), (1), (1), (1)
Applications (9), (7), (4), (1), (1)
Epitopes (3), (2), (2), (2)
back to top