Did you know that you can buy products from over 140 different suppliers from us?

Wingless-Type MMTV Integration Site Family, Member 9B (WNT9B) (C-Term) antibody

Details for Product No. ABIN184102
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms WNT9B, wnt-9b, Wnt14b, Wnt15, clf, clf1, wnt-14b, wnt-15, WNT14B, WNT15
Epitope
C-Term
(8), (1), (1), (1), (1), (1), (1)
Reactivity
Human
(14), (3), (2), (1)
Host
Rabbit
(13), (3), (1)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(13), (5), (4), (2), (1)
Pubmed 2 references available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN184102
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human WNT9B
Sequence FRETGQVLKLRYDSAVKVSSATNEALGRLELWAPARQGSL TKGLAPRSGD
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against WNT9B. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name WNT9B
Background WNT9B is a member of the WNT family. They are secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis.The WNT gene family consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. Study of its expression in the teratocarcinoma cell line NT2 suggests that it may be implicated in the early process of neuronal differentiation of NT2 cells induced by retinoic acid. This gene is clustered with WNT3, another family member, in the chromosome 17q21 region.
Molecular Weight 39 kDa
Gene ID 7484
NCBI Accession NM_003396, NP_003387
UniProt O14905
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 357 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Wingless-Type MMTV Integration Site Family, Member 9B (WNT9B) (C-Term) antibody WB Suggested Anti-WNT9B Antibody Titration: 5.0ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate
anti-Wingless-Type MMTV Integration Site Family, Member 9B (WNT9B) (C-Term) antibody (2) anti-Wingless-Type MMTV Integration Site Family, Member 9B (WNT9B) (C-Term) antibody (Image 2)
anti-Wingless-Type MMTV Integration Site Family, Member 9B (WNT9B) (C-Term) antibody (3) WB Suggested Anti-WNT9B
Antibody Titration: 5.0 µg/mL ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

General Clark, Edwards, Peterson et al.: "Fugu ESTs: new resources for transcription analysis and genome annotation." in: Genome research, Vol. 13, Issue 12, pp. 2747-53, 2003 (PubMed).

Validation Images
back to top