Wingless-Type MMTV Integration Site Family, Member 9B (WNT9B) antibody

Antigen: Wingless-Type MMTV Integration Site Family, Member 9B (WNT9B)

Synonyms: WNT15, WNT14B, WNT9B

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN184102

Additional Information

Alternative name: WNT9B

Gene ID: WNT9B

UniProt: O14905

Immunogen: The immunogen for anti-WNT9B antibody: synthetic peptide directed towards the C terminal of human WNT9B

Sequence: FRETGQVLKLRYDSAVKVSSATNEALGRLELWAPARQGSL TKGLAPRSGD

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-WNT9B antibody concentration is 1 mg/ml.

Description: WNT9B is a member of the WNT family. They are secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis.The WNT gene family consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. Study of its expression in the teratocarcinoma cell line NT2 suggests that it may be implicated in the early process of neuronal differentiation of NT2 cells induced by retinoic acid. This gene is clustered with WNT3, another family member, in the chromosome 17q21 region.

Characteristics: Antigen Size: 357 amino acids

Molecular Weight: 39kDa

Application Details

Application Notes: WB Suggested Anti-WNT9B Antibody Titration: 5.0ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-WNT9B Antibody Titration: 5.0ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate

anti-Wingless-Type MMTV Integration Site Family, Member 9B (WNT9B) antibody (Image 2)

Publications

Clark, Edwards, Peterson et al.: "Fugu ESTs: new resources for transcription analysis and genome annotation." in: Genome research, Vol. 13, Issue 12, pp. 2747-53, 2003 (PubMed).

Product: Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).