Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN184115

Cell Division Cycle 25 Homolog B (S. Pombe) (CDC25B) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AI604853, CDC25B
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Dog (Canine), Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN184115
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CDC25B antibody: synthetic peptide directed towards the N terminal of human CDC25B
Sequence TQTMHDLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRAS ESSLSSESSE
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Pig : 100%, Rabbit : 92%, Mouse : 85%, Rat : 85%
Characteristics This is a rabbit polyclonal antibody against CDC25B. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name CDC25B
Background CDC25B is a member of the CDC25 family of phosphatases. CDC25B activates the cyclin dependent kinase CDC2 by removing two phosphate groups and it is required for entry into mitosis. CDC25B shuttles between the nucleus and the cytoplasm due to nuclear localization and nuclear export signals. The protein is nuclear in the M and G1 phases of the cell cycle and moves to the cytoplasm during S and G2. CDC25B has oncogenic properties, although its role in tumor formation has not been determined.CDC25B is a member of the CDC25 family of phosphatases. CDC25B activates the cyclin dependent kinase CDC2 by removing two phosphate groups and it is required for entry into mitosis. CDC25B shuttles between the nucleus and the cytoplasm due to nuclear localization and nuclear export signals. The protein is nuclear in the M and G1 phases of the cell cycle and moves to the cytoplasm during S and G2. CDC25B has oncogenic properties, although its role in tumor formation has not been determined. Multiple transcript variants for this gene exist.
Molecular Weight 65kDa
Gene ID 994
NCBI Accession NP_068659, NM_021873
UniProt P30305
Research Area Cell Cycle, Cancer, Kinases/Phosphatases
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CDC25B antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Mirey, Chartrain, Froment et al.: "CDC25B phosphorylated by pEg3 localizes to the centrosome and the spindle poles at mitosis." in: Cell cycle (Georgetown, Tex.), Vol. 4, Issue 6, pp. 806-11, 2005 (PubMed).

Alternatives for antigen "Cell Division Cycle 25 Homolog B (S. Pombe) (CDC25B)", type "Antibodies"
Hosts (134), (9), (3)
Reactivities (138), (85), (82), (13), (13), (12)
Applications (95), (53), (50), (34), (25), (16), (5), (3), (2), (1), (1)
Conjugates (6), (5), (5), (5), (5), (5), (5), (5), (5), (5), (5)
Epitopes (22), (18), (18), (13), (7), (7), (5), (3), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1)
Beacon