Cell Division Cycle 25 Homolog B (S. Pombe) (CDC25B) (N-Term) antibody

Details for Product No. ABIN184115
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AI604853, CDC25B
Epitope
N-Term
(24), (22), (20), (14), (13), (13), (13), (6), (5), (3), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Dog (Canine), Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Human
(176), (91), (87), (13), (13), (12)
Host
Rabbit
(175), (9), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(11), (10), (10), (5), (5), (5), (5), (5), (5), (5), (5), (5), (5), (5)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(136), (83), (50), (47), (33), (20), (9), (3), (3), (2)
Pubmed 1 reference available
Catalog no. ABIN184115
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human CDC25B
Sequence TQTMHDLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRAS ESSLSSESSE
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Pig : 100 %, Rabbit : 90 %, Mouse : 80 %, Rat : 80 %
Characteristics This is a rabbit polyclonal antibody against CDC25B. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name CDC25B
Background CDC25B is a member of the CDC25 family of phosphatases. CDC25B activates the cyclin dependent kinase CDC2 by removing two phosphate groups and it is required for entry into mitosis. CDC25B shuttles between the nucleus and the cytoplasm due to nuclear localization and nuclear export signals. The protein is nuclear in the M and G1 phases of the cell cycle and moves to the cytoplasm during S and G2. CDC25B has oncogenic properties, although its role in tumor formation has not been determined.CDC25B is a member of the CDC25 family of phosphatases. CDC25B activates the cyclin dependent kinase CDC2 by removing two phosphate groups and it is required for entry into mitosis. CDC25B shuttles between the nucleus and the cytoplasm due to nuclear localization and nuclear export signals. The protein is nuclear in the M and G1 phases of the cell cycle and moves to the cytoplasm during S and G2. CDC25B has oncogenic properties, although its role in tumor formation has not been determined. Multiple transcript variants for this gene exist.
Molecular Weight 65 kDa
Gene ID 994
NCBI Accession NM_021873, NP_068659
UniProt P30305
Research Area Cell Cycle, Cancer, Kinases/Phosphatases
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 580 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Cell Division Cycle 25 Homolog B (S. Pombe) (CDC25B) (N-Term) antibody WB Suggested Anti-CDC25B Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
anti-Cell Division Cycle 25 Homolog B (S. Pombe) (CDC25B) (N-Term) antibody (2) anti-Cell Division Cycle 25 Homolog B (S. Pombe) (CDC25B) (N-Term) antibody (Image 2)
Background publications Mirey, Chartrain, Froment et al.: "CDC25B phosphorylated by pEg3 localizes to the centrosome and the spindle poles at mitosis." in: Cell cycle (Georgetown, Tex.), Vol. 4, Issue 6, pp. 806-11, 2005 (PubMed).

Hosts (175), (9), (2)
Reactivities (176), (91), (87), (13), (13), (12)
Applications (136), (83), (50), (47), (33), (20), (9), (3), (3), (2)
Conjugates (11), (10), (10), (5), (5), (5), (5), (5), (5), (5), (5), (5), (5), (5)
Epitopes (24), (22), (20), (14), (13), (13), (13), (6), (5), (3), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top