Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN184132

Cyclin-Dependent Kinase 4 (CDK4) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CMM3, PSK-J3, Crk3, 8-6, CDK4, CDK4/6, CG5072, Cdk4/6, DmCdk4, Dmel\\CG5072, Pk53C, Pk?7, cdk, cdk4, cdk4/6, dCdk4, l(2)05428, l(2)0671, l(2)k06503, l(2)s4639, l(2)sh0671, zgc:153726
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN184132
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CDK4 antibody: synthetic peptide directed towards the C terminal of human CDK4
Sequence PRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHS YLHKDEGNPE
Predicted Reactivity Human : 100%, Pig : 92%, Dog : 85%, Rabbit : 85%, Bovine : 78%, Rat : 78%, Sheep : 78%
Characteristics This is a rabbit polyclonal antibody against CDK4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name CDK4
Background Cdk4 is probably involved in the control of the cell cycle.
Molecular Weight 34kDa
Gene ID 1019
NCBI Accession NP_000066, NM_000075
UniProt P11802
Research Area Cell Cycle
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CDK4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Elkahloun, Krizman, Wang et al.: "Transcript mapping in a 46-kb sequenced region at the core of 12q13.3 amplification in human cancers." in: Genomics, Vol. 42, Issue 2, pp. 295-301, 1997 (PubMed).

Alternatives for antigen "Cyclin-Dependent Kinase 4 (CDK4)", type "Antibodies"
Hosts (83), (76), (4), (3), (1)
Reactivities (159), (61), (48), (19), (13), (2), (1)
Applications (149), (61), (44), (43), (16), (14), (10), (10), (8), (8), (5), (5), (2), (1), (1), (1)
Conjugates (4), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (25), (10), (7), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Beacon