Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN184133

Keratin 15 (KRT15) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms K15, CK15, K1CO, Krt1-15, AI528832, Ka15, zgc:55334, wu:fa91c06, wu:fa95d04, xlk2
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN184133
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-KRT15 antibody: synthetic peptide directed towards the C terminal of human KRT15
Sequence RSLLEGQDAKMAGIGIREASSGGGGSSSNFHINVEESVDG QVVSSHKREI
Predicted Reactivity Human : 100%, Bovine : 86%, Mouse : 86%
Characteristics This is a rabbit polyclonal antibody against KRT15. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name KRT15
Background The protein encoded by KRT15 is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains and are clustered in a region on chromosome 17q21.2. The protein encoded by this gene is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains and are clustered in a region on chromosome 17q21.2.
Molecular Weight 49kDa
Gene ID 3866
NCBI Accession NP_002266, NM_002275
UniProt P19012
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-KRT15 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Radoja, Stojadinovic, Waseem et al.: "Thyroid hormones and gamma interferon specifically increase K15 keratin gene transcription." in: Molecular and cellular biology, Vol. 24, Issue 8, pp. 3168-79, 2004 (PubMed).

Alternatives for antigen "Keratin 15 (KRT15)", type "Antibodies"
Hosts (69), (28), (7)
Reactivities (94), (47), (47), (35), (29), (17), (12), (2), (2)
Applications (58), (31), (30), (26), (24), (20), (19), (18), (4), (3), (3), (3), (2), (1)
Conjugates (6), (4), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Epitopes (13), (3), (3), (2), (2), (1)
Beacon