Did you know that you can buy products from over 140 different suppliers from us?

Keratin 15 (KRT15) (C-Term) antibody

Details for Product No. ABIN184133
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms xlk2, CK15, K15, K1CO, AI528832, Krt1-15, Ka15, wu:fa91c06, wu:fa95d04, zgc:55334
Epitope
C-Term
(16), (5), (3), (3), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(100), (51), (49), (33), (29), (17), (12), (2), (2)
Host
Rabbit
(72), (28), (7)
Clonality
Polyclonal
Conjugate
Un-conjugated
(4), (4), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(63), (32), (32), (27), (24), (20), (20), (12), (8), (3), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN184133
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human KRT15
Sequence RSLLEGQDAKMAGIGIREASSGGGGSSSNFHINVEESVDG QVVSSHKREI
Predicted Reactivity Human : 100 %, Bovine : 80 %, Mouse : 80 %
Characteristics This is a rabbit polyclonal antibody against KRT15. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name KRT15
Background The protein encoded by KRT15 is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains and are clustered in a region on chromosome 17q21.2. The protein encoded by this gene is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains and are clustered in a region on chromosome 17q21.2.
Molecular Weight 49 kDa
Gene ID 3866
NCBI Accession NM_002275, NP_002266
UniProt P19012
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 456 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Keratin 15 (KRT15) (C-Term) antibody WB Suggested Anti-KRT15 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human brain
anti-Keratin 15 (KRT15) (C-Term) antibody (2) anti-Keratin 15 (KRT15) (C-Term) antibody (Image 2)
Background publications Radoja, Stojadinovic, Waseem et al.: "Thyroid hormones and gamma interferon specifically increase K15 keratin gene transcription." in: Molecular and cellular biology, Vol. 24, Issue 8, pp. 3168-79, 2004 (PubMed).

Validation Images
back to top