Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN184220

Cholinergic Receptor, Nicotinic, beta 2 (Neuronal) (CHRNB2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Acrb2, Acrb-2, [b]2-nAchR, C030030P04Rik, EFNL3, nAChRB2, NACHRB2
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN184220
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CHRNB2 antibody: synthetic peptide directed towards the N terminal of human CHRNB2
Sequence SGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQL MVSLAQLISV
Predicted Reactivity Bovine : 100%, Dog : 100%, Human : 100%, Mouse : 100%, Pig : 100%, African clawed frog : 92%, Zebrafish : 83%
Characteristics This is a rabbit polyclonal antibody against CHRNB2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CHRNB2
Background CHRNB2 is a neuronal nicotinic acetylcholine receptor (nAChR) that belong to ligand-gated ion channels composed of alpha and beta subunits with specific structural, functional and pharmacological properties.
Molecular Weight 57kDa
Gene ID 1141
NCBI Accession NP_000739, NM_000748
UniProt P17787
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CHRNB2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Feng, Niu, Xing et al.: "A common haplotype of the nicotine acetylcholine receptor alpha 4 subunit gene is associated with vulnerability to nicotine addiction in men." in: American journal of human genetics, Vol. 75, Issue 1, pp. 112-21, 2004 (PubMed).

Alternatives for antigen "Cholinergic Receptor, Nicotinic, beta 2 (Neuronal) (CHRNB2)", type "Antibodies"
Hosts (39), (6), (1)
Reactivities (42), (22), (20), (19), (19), (19), (18), (2)
Applications (31), (16), (15), (10), (6), (6), (5), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (4), (3), (3), (2), (1), (1)
Beacon