Cholinergic Receptor, Nicotinic, beta 2 (Neuronal) (CHRNB2) (N-Term) antibody

Details for Product No. ABIN184220
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms Acrb2, Acrb-2, [b]2-nAchR, C030030P04Rik, EFNL3, nAChRB2, NACHRB2
Epitope
N-Term
(6), (3), (3), (2), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Human, Chicken
(41), (22), (20), (19), (19), (19), (18), (2)
Host
Rabbit
(37), (5), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(30), (15), (14), (10), (8), (5), (5), (3), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN184220
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human CHRNB2
Sequence SGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQL MVSLAQLISV
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, African clawed frog : 90 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against CHRNB2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name CHRNB2
Background CHRNB2 is a neuronal nicotinic acetylcholine receptor (nAChR) that belong to ligand-gated ion channels composed of alpha and beta subunits with specific structural, functional and pharmacological properties.
Molecular Weight 57 kDa
Gene ID 1141
NCBI Accession NM_000748, NP_000739
UniProt P17787
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 502 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Cholinergic Receptor, Nicotinic, beta 2 (Neuronal) (CHRNB2) (N-Term) antibody WB Suggested Anti-CHRNB2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
Background publications Feng, Niu, Xing et al.: "A common haplotype of the nicotine acetylcholine receptor alpha 4 subunit gene is associated with vulnerability to nicotine addiction in men." in: American journal of human genetics, Vol. 75, Issue 1, pp. 112-21, 2004 (PubMed).

Hosts (37), (5), (3)
Reactivities (41), (22), (20), (19), (19), (19), (18), (2)
Applications (30), (15), (14), (10), (8), (5), (5), (3), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (3), (3), (2), (2), (1), (1)
back to top